PTBP1 monoclonal antibody (M01), clone 3H8
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
-
Specification
Product Description
Mouse monoclonal antibody raised against a partial recombinant PTBP1.
Immunogen
PTBP1 (NP_002810, 45 a.a. ~ 144 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Sequence
KKFKGDSRSAGVPSRVIHIRKLPIDVTEGEVISLGLPFGKVTNLLMLKGKNQAFIEMNTEEAANTMVNYYTSVTPVLRGQPIYIQFSNHKELKTDSSPNQ
Host
Mouse
Reactivity
Human
Interspecies Antigen Sequence
Mouse (96); Rat (94)
Isotype
IgG1 Kappa
Quality Control Testing
Antibody Reactive Against Recombinant Protein.
Western Blot detection against Immunogen (36.74 KDa) .
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Cell lysate)
PTBP1 monoclonal antibody (M01), clone 3H8 Western Blot analysis of PTBP1 expression in A-431 ( Cat # L015V1 ).Western Blot (Transfected lysate)
Western Blot analysis of PTBP1 expression in transfected 293T cell line by PTBP1 monoclonal antibody (M01), clone 3H8.
Lane 1: PTBP1 transfected lysate(59.6 KDa).
Lane 2: Non-transfected lysate.
Western Blot (Recombinant protein)
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
Immunoperoxidase of monoclonal antibody to PTBP1 on formalin-fixed paraffin-embedded human kidney. [antibody concentration 3 ug/ml]Immunoprecipitation
Immunoprecipitation of PTBP1 transfected lysate using anti-PTBP1 monoclonal antibody and Protein A Magnetic Bead, and immunoblotted with PTBP1 MaxPab rabbit polyclonal antibody.Sandwich ELISA (Recombinant protein)
Detection limit for recombinant GST tagged PTBP1 is approximately 0.1ng/ml as a capture antibody.ELISA
Immunofluorescence
Immunofluorescence of monoclonal antibody to PTBP1 on HeLa cell. [antibody concentration 10 ug/ml] -
Gene Info — PTBP1
Entrez GeneID
5725GeneBank Accession#
NM_002819Protein Accession#
NP_002810Gene Name
PTBP1
Gene Alias
HNRNP-I, HNRNPI, HNRPI, MGC10830, MGC8461, PTB, PTB-1, PTB-T, PTB2, PTB3, PTB4, pPTB
Gene Description
polypyrimidine tract binding protein 1
Omim ID
600693Gene Ontology
HyperlinkGene Summary
This gene belongs to the subfamily of ubiquitously expressed heterogeneous nuclear ribonucleoproteins (hnRNPs). The hnRNPs are RNA-binding proteins and they complex with heterogeneous nuclear RNA (hnRNA). These proteins are associated with pre-mRNAs in the nucleus and appear to influence pre-mRNA processing and other aspects of mRNA metabolism and transport. While all of the hnRNPs are present in the nucleus, some seem to shuttle between the nucleus and the cytoplasm. The hnRNP proteins have distinct nucleic acid binding properties. The protein encoded by this gene has four repeats of quasi-RNA recognition motif (RRM) domains that bind RNAs. This protein binds to the intronic polypyrimidine tracts that requires pre-mRNA splicing and acts via the protein degradation ubiquitin-proteasome pathway. It may also promote the binding of U2 snRNP to pre-mRNAs. This protein is localized in the nucleoplasm and it is also detected in the perinucleolar structure. Alternatively spliced transcript variants encoding different isoforms have been described. [provided by RefSeq
Other Designations
RNA-binding protein|heterogeneous nuclear ribonucleoprotein I|heterogeneous nuclear ribonucleoprotein polypeptide I|polypyrimidine tract binding protein (heterogeneous nuclear ribonucleoprotein I)|polypyrimidine tract-binding protein 1
-
Interactome
-
Disease
-
Publication Reference
-
PKM1 Confers Metabolic Advantages and Promotes Cell-Autonomous Tumor Cell Growth.
Mami Morita, Taku Sato, Miyuki Nomura, Yoshimi Sakamoto, Yui Inoue, Ryota Tanaka, Shigemi Ito, Koreyuki Kurosawa, Kazunori Yamaguchi, Yuki Sugiura, Hiroshi Takizaki, Yoji Yamashita, Ryuichi Katakura, Ikuro Sato, Masaaki Kawai, Yoshinori Okada, Hitomi Watanabe, Gen Kondoh, Shoko Matsumoto0, Ayako Kishimoto0, Miki Obata, Masaki Matsumoto, Tatsuro Fukuhara, Hozumi Motohashi, Makoto Suematsu, Masaaki Komatsu, Keiichi I Nakayama, Toshio Watanabe0, Tomoyoshi Soga, Hiroshi Shima, Makoto Maemondo, Nobuh
Cancer Cell 2018 Mar; 33(3):355.
Application:WB-Tr, Human, HeLa cells.
-
Subcellular western blotting of single cells.
Yamauchi KA, Herr AE.
Microsystems & nanoengineering 2017 Feb; [Epub].
Application:IF, Human, U373 MG human glioblastoma cells.
-
PKM1 Confers Metabolic Advantages and Promotes Cell-Autonomous Tumor Cell Growth.
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com