PSPH monoclonal antibody (M02), clone 2G9
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
Western Blot (Cell lysate)
PSPH monoclonal antibody (M02), clone 2G9 Western Blot analysis of PSPH expression in K-562 ( Cat # L009V1 ).
Western Blot (Transfected lysate)
Western Blot analysis of PSPH expression in transfected 293T cell line by PSPH monoclonal antibody (M02), clone 2G9.
Lane 1: PSPH transfected lysate(25 KDa).
Lane 2: Non-transfected lysate.
Sandwich ELISA (Recombinant protein)
Detection limit for recombinant GST tagged PSPH is approximately 0.1ng/ml as a capture antibody.
Western Blot detection against Immunogen (50.49 KDa) .
-
Specification
Product Description
Mouse monoclonal antibody raised against a full length recombinant PSPH.
Immunogen
PSPH (AAH63614, 1 a.a. ~ 225 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Sequence
MVSHSELRKLFYSADAVCFDVDSTVIREEGIDELAKICGVEDAVSEMTRRAMGGAVPFKAALTERLALIQPSREQVQRLIAEQPPHLTPGIRELVSRLQERNVQVFLISGGFRSIVEHVASKLNIPATNVFANRLKFYFNGEYAGFDETQPTAESGGKGKVIKLLKEKFHFKKIIMIGDGATDMEACPPADAFIGFGGNVIRQQVKDNAKWYITDFVELLGELEE
Host
Mouse
Reactivity
Human
Isotype
IgG1 kappa
Quality Control Testing
Antibody Reactive Against Recombinant Protein.
Western Blot detection against Immunogen (50.49 KDa) .
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Cell lysate)
PSPH monoclonal antibody (M02), clone 2G9 Western Blot analysis of PSPH expression in K-562 ( Cat # L009V1 ).Western Blot (Transfected lysate)
Western Blot analysis of PSPH expression in transfected 293T cell line by PSPH monoclonal antibody (M02), clone 2G9.
Lane 1: PSPH transfected lysate(25 KDa).
Lane 2: Non-transfected lysate.
Western Blot (Recombinant protein)
Sandwich ELISA (Recombinant protein)
Detection limit for recombinant GST tagged PSPH is approximately 0.1ng/ml as a capture antibody.ELISA
-
Gene Info — PSPH
Entrez GeneID
5723GeneBank Accession#
BC063614Protein Accession#
AAH63614Gene Name
PSPH
Gene Alias
PSP
Gene Description
phosphoserine phosphatase
Omim ID
172480Gene Ontology
HyperlinkGene Summary
The protein encoded by this gene belongs to a subfamily of the phosphotransferases. This encoded enzyme is responsible for the third and last step in L-serine formation. It catalyzes magnesium-dependent hydrolysis of L-phosphoserine and is also involved in an exchange reaction between L-serine and L-phosphoserine. Deficiency of this protein is thought to be linked to Williams syndrome. [provided by RefSeq
Other Designations
L-3-phosphoserine phosphatase|O-phosphoserine phosphohydrolase|OTTHUMP00000025059|PSPase
-
Interactome
-
Pathway
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com