PSME2 monoclonal antibody (M02), clone 1G4
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
Western Blot (Cell lysate)
PSME2 monoclonal antibody (M02), clone 1G4 Western Blot analysis of PSME2 expression in MCF-7 ( Cat # L046V1 ).
Western Blot (Transfected lysate)
Western Blot analysis of PSME2 expression in transfected 293T cell line by PSME2 monoclonal antibody (M02), clone 1G4.
Lane 1: PSME2 transfected lysate(27.4 KDa).
Lane 2: Non-transfected lysate.
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
Immunoperoxidase of monoclonal antibody to PSME2 on formalin-fixed paraffin-embedded human stomach carcinoma. [antibody concentration 6 ug/ml]
Immunoprecipitation
Immunoprecipitation of PSME2 transfected lysate using anti-PSME2 monoclonal antibody and Protein A Magnetic Bead, and immunoblotted with PSME2 MaxPab rabbit polyclonal antibody.
Sandwich ELISA (Recombinant protein)
Detection limit for recombinant GST tagged PSME2 is approximately 0.3ng/ml as a capture antibody.
Western Blot detection against Immunogen (35.64 KDa) .
-
Specification
Product Description
Mouse monoclonal antibody raised against a partial recombinant PSME2.
Immunogen
PSME2 (NP_002809, 1 a.a. ~ 90 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Sequence
MAKPCGVRLSGEARKQVEVFRQNLFQEAEEFLYRFLPQKIIYLNQLLQEDSLNVADLTSLRAPLDIPIPDPPPKDDEMETDKQEKKEVHK
Host
Mouse
Reactivity
Human
Isotype
IgG2a Kappa
Quality Control Testing
Antibody Reactive Against Recombinant Protein.
Western Blot detection against Immunogen (35.64 KDa) .
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Cell lysate)
PSME2 monoclonal antibody (M02), clone 1G4 Western Blot analysis of PSME2 expression in MCF-7 ( Cat # L046V1 ).Western Blot (Transfected lysate)
Western Blot analysis of PSME2 expression in transfected 293T cell line by PSME2 monoclonal antibody (M02), clone 1G4.
Lane 1: PSME2 transfected lysate(27.4 KDa).
Lane 2: Non-transfected lysate.
Western Blot (Recombinant protein)
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
Immunoperoxidase of monoclonal antibody to PSME2 on formalin-fixed paraffin-embedded human stomach carcinoma. [antibody concentration 6 ug/ml]Immunoprecipitation
Immunoprecipitation of PSME2 transfected lysate using anti-PSME2 monoclonal antibody and Protein A Magnetic Bead, and immunoblotted with PSME2 MaxPab rabbit polyclonal antibody.Sandwich ELISA (Recombinant protein)
Detection limit for recombinant GST tagged PSME2 is approximately 0.3ng/ml as a capture antibody.ELISA
-
Gene Info — PSME2
Entrez GeneID
5721GeneBank Accession#
NM_002818Protein Accession#
NP_002809Gene Name
PSME2
Gene Alias
PA28B, PA28beta, REGbeta
Gene Description
proteasome (prosome, macropain) activator subunit 2 (PA28 beta)
Omim ID
602161Gene Ontology
HyperlinkGene Summary
The 26S proteasome is a multicatalytic proteinase complex with a highly ordered structure composed of 2 complexes, a 20S core and a 19S regulator. The 20S core is composed of 4 rings of 28 non-identical subunits; 2 rings are composed of 7 alpha subunits and 2 rings are composed of 7 beta subunits. The 19S regulator is composed of a base, which contains 6 ATPase subunits and 2 non-ATPase subunits, and a lid, which contains up to 10 non-ATPase subunits. Proteasomes are distributed throughout eukaryotic cells at a high concentration and cleave peptides in an ATP/ubiquitin-dependent process in a non-lysosomal pathway. An essential function of a modified proteasome, the immunoproteasome, is the processing of class I MHC peptides. The immunoproteasome contains an alternate regulator, referred to as the 11S regulator or PA28, that replaces the 19S regulator. Three subunits (alpha, beta and gamma) of the 11S regulator have been identified. This gene encodes the beta subunit of the 11S regulator, one of the two 11S subunits that is induced by gamma-interferon. Three beta and three alpha subunits combine to form a heterohexameric ring. Six pseudogenes have been identified on chromosomes 4, 5, 8, 10 and 13. [provided by RefSeq
Other Designations
11S regulator complex beta subunit|MCP activator, 31-kD subunit|activator of multicatalytic protease subunit 2|cell migration-inducing protein 22|proteasome activator 28-beta|proteasome activator hPA28 subunit beta|proteasome activator subunit 2
-
Interactome
-
Pathway
-
Disease
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com