PSME1 purified MaxPab mouse polyclonal antibody (B02P)

Catalog # H00005720-B02P

Size

Price

Stock

Quantity

Size:50 ug
Price: USD $ 335.00
Stock:
order now, ship in 3 months
abnova-minus
abnova-plus

* The price is valid only in USA. Please select country.

Contact Info
  • +1-909-264-1399
    +1-909-992-0619
    Toll Free : +1-877-853-6098
  • +1-909-992-3401
Images
Western Blot (Tissue lysate)
Application

Western Blot (Tissue lysate)

PSME1 MaxPab polyclonal antibody. Western Blot analysis of PSME1 expression in human kidney.

Western Blot (Transfected lysate)
Application

Western Blot (Transfected lysate)

Western Blot analysis of PSME1 expression in transfected 293T cell line (H00005720-T02) by PSME1 MaxPab polyclonal antibody.

Lane 1: PSME1 transfected lysate(27.39 KDa).
Lane 2: Non-transfected lysate.

  • Specification

    Product Description

    Mouse polyclonal antibody raised against a full-length human PSME1 protein.MaxPab Polyclonal Antibody,MaxPab Polyclonal Antibodies,MaxPab,DNA Immune,DNA Immunization,Immune Technology

    Immunogen

    PSME1 (NP_006254.1, 1 a.a. ~ 249 a.a) full-length human protein.

    Sequence

    MAMLRVQPEAQAKVDVFREDLCTKTENLLGSYFPKKISELDAFLKEPALNEANLSNLKAPLDIPVPDPVKEKEKEERKKQQEKEDKDEKKKGEDEDKGPPCGPVNCNEKIVVLLQRLKPEIKDVIEQLNLVTTWLQLQIPRIEDGNNFGVAVQEKVFELMTSLHTKLEGFHTQISKYFSERGDAVTKAAKQPHVGDYRQLVHELDEAEYRDIRLMVMEIRNAYAVLYDIILKNFEKLKKPRGETKGMIY

    Host

    Mouse

    Reactivity

    Human

    Interspecies Antigen Sequence

    Mouse (95); Rat (96)

    Quality Control Testing

    Antibody reactive against mammalian transfected lysate.

    Storage Buffer

    In 1x PBS, pH 7.4

    Storage Instruction

    Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.

  • Applications

    Western Blot (Tissue lysate)

    PSME1 MaxPab polyclonal antibody. Western Blot analysis of PSME1 expression in human kidney.

    Western Blot (Transfected lysate)

    Western Blot analysis of PSME1 expression in transfected 293T cell line (H00005720-T02) by PSME1 MaxPab polyclonal antibody.

    Lane 1: PSME1 transfected lysate(27.39 KDa).
    Lane 2: Non-transfected lysate.
  • Gene Info — PSME1

    Entrez GeneID

    5720

    GeneBank Accession#

    NM_006263

    Protein Accession#

    NP_006254.1

    Gene Name

    PSME1

    Gene Alias

    IFI5111, MGC8628, PA28A, PA28alpha, REGalpha

    Gene Description

    proteasome (prosome, macropain) activator subunit 1 (PA28 alpha)

    Omim ID

    600654

    Gene Ontology

    Hyperlink

    Gene Summary

    The 26S proteasome is a multicatalytic proteinase complex with a highly ordered structure composed of 2 complexes, a 20S core and a 19S regulator. The 20S core is composed of 4 rings of 28 non-identical subunits; 2 rings are composed of 7 alpha subunits and 2 rings are composed of 7 beta subunits. The 19S regulator is composed of a base, which contains 6 ATPase subunits and 2 non-ATPase subunits, and a lid, which contains up to 10 non-ATPase subunits. Proteasomes are distributed throughout eukaryotic cells at a high concentration and cleave peptides in an ATP/ubiquitin-dependent process in a non-lysosomal pathway. An essential function of a modified proteasome, the immunoproteasome, is the processing of class I MHC peptides. The immunoproteasome contains an alternate regulator, referred to as the 11S regulator or PA28, that replaces the 19S regulator. Three subunits (alpha, beta and gamma) of the 11S regulator have been identified. This gene encodes the alpha subunit of the 11S regulator, one of the two 11S subunits that is induced by gamma-interferon. Three alpha and three beta subunits combine to form a heterohexameric ring. Two transcripts encoding different isoforms have been identified. [provided by RefSeq

    Other Designations

    11S regulator complex alpha subunit|29-kD MCP activator subunit|activator of multicatalytic protease subunit 1|interferon gamma up-regulated I-5111 protein|interferon-gamma IEF SSP 5111|interferon-gamma-inducible protein 5111|proteasome activator subunit

  • Interactome
  • Pathway
Contact Info
  • +1-909-264-1399
    +1-909-992-0619
    Toll Free : +1-877-853-6098
  • +1-909-992-3401
4 Products to Compare
Remove All