PSMD8 purified MaxPab mouse polyclonal antibody (B02P)
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
-
Specification
Product Description
Mouse polyclonal antibody raised against a full-length human PSMD8 protein.
Immunogen
PSMD8 (NP_002803.1, 1 a.a. ~ 257 a.a) full-length human protein.
Sequence
MYEQLKGEWNRKSPNLSKCGEELGRLKLVLLELNFLPTTGTKLTKQQLILARDILEIGAQWSILRKDIPSFERYMAQLKCYYFDYKEQLPESAYMHQLLGLNLLFLLSQNRVAEFHTELERLPAKDIQTNVYIKHPVSLEQYLMEGSYNKVFLAKGNIPAESYTFFIDILLDTIRDEIAGCIEKAYEKILFTEATRILFFNTPKKMTDYAKKRGWVLGPNNYYSFASQQQKPEDTTIPSTELAKQVIEYARQLEMIV
Host
Mouse
Reactivity
Human
Quality Control Testing
Antibody reactive against mammalian transfected lysate.
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Tissue lysate)
PSMD8 MaxPab polyclonal antibody. Western Blot analysis of PSMD8 expression in human placenta.Western Blot (Transfected lysate)
Western Blot analysis of PSMD8 expression in transfected 293T cell line (H00005714-T02) by PSMD8 MaxPab polyclonal antibody.
Lane 1: PSMD8 transfected lysate(28.27 KDa).
Lane 2: Non-transfected lysate.
-
Gene Info — PSMD8
Entrez GeneID
5714GeneBank Accession#
NM_002812Protein Accession#
NP_002803.1Gene Name
PSMD8
Gene Alias
HIP6, HYPF, MGC1660, Nin1p, Rpn12, S14, p31
Gene Description
proteasome (prosome, macropain) 26S subunit, non-ATPase, 8
Gene Ontology
HyperlinkGene Summary
The 26S proteasome is a multicatalytic proteinase complex with a highly ordered structure composed of 2 complexes, a 20S core and a 19S regulator. The 20S core is composed of 4 rings of 28 non-identical subunits; 2 rings are composed of 7 alpha subunits and 2 rings are composed of 7 beta subunits. The 19S regulator is composed of a base, which contains 6 ATPase subunits and 2 non-ATPase subunits, and a lid, which contains up to 10 non-ATPase subunits. Proteasomes are distributed throughout eukaryotic cells at a high concentration and cleave peptides in an ATP/ubiquitin-dependent process in a non-lysosomal pathway. An essential function of a modified proteasome, the immunoproteasome, is the processing of class I MHC peptides. This gene encodes a non-ATPase subunit of the 19S regulator. A pseudogene has been identified on chromosome 1. [provided by RefSeq
Other Designations
26S proteasome non-ATPase regulatory subunit 8|26S proteasome regulatory subunit S14|26S proteasome regulatory subunit p31|proteasome 26S non-ATPase subunit 8
-
Interactome
-
Pathway
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com