Product Browser

Last updated: 2016/12/4
  • Related Product Showcase
  • By Research Area

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

PSMC6 polyclonal antibody (A01)

  • Catalog # : H00005706-A01
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Mouse polyclonal antibody raised against a partial recombinant PSMC6.
  • Immunogen:
  • PSMC6 (AAH05390, 290 a.a. ~ 389 a.a) partial recombinant protein with GST tag.
  • Sequence:
  • LRPGRLDRKIHIDLPNEQARLDILKIHAGPITKHGEIDYEAIVKLSDGFNGADLRNVCTEAGMFAIRADHDFVVQEDFMKAVRKVADSKKLESKLDYKPV
  • Host:
  • Mouse
  • Reactivity:
  • Human
  • Quality Control Testing:
  • Antibody Reactive Against Recombinant Protein.

    QC Testing of H00005706-A01
    Western Blot detection against Immunogen (37.11 KDa) .
  • Storage Buffer:
  • 50 % glycerol
  • Storage Instruction:
  • Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
  • Applications
  • ELISA
  • Application Image
  • Western Blot (Recombinant protein)
  • ELISA
  • Gene Information
  • Entrez GeneID:
  • 5706
  • Gene Name:
  • PSMC6
  • Gene Alias:
  • CADP44,MGC12520,P44,SUG2,p42
  • Gene Description:
  • proteasome (prosome, macropain) 26S subunit, ATPase, 6
  • Gene Summary:
  • The 26S proteasome is a multicatalytic proteinase complex with a highly ordered structure composed of 2 complexes, a 20S core and a 19S regulator. The 20S core is composed of 4 rings of 28 non-identical subunits; 2 rings are composed of 7 alpha subunits and 2 rings are composed of 7 beta subunits. The 19S regulator is composed of a base, which contains 6 ATPase subunits and 2 non-ATPase subunits, and a lid, which contains up to 10 non-ATPase subunits. Proteasomes are distributed throughout eukaryotic cells at a high concentration and cleave peptides in an ATP/ubiquitin-dependent process in a non-lysosomal pathway. An essential function of a modified proteasome, the immunoproteasome, is the processing of class I MHC peptides. This gene encodes one of the ATPase subunits, a member of the triple-A family of ATPases which have a chaperone-like activity. Pseudogenes have been identified on chromosomes 8 and 12. [provided by RefSeq
  • Other Designations:
  • 26S protease regulatory subunit S10B,conserved ATPase domain protein 44,proteasome 26S ATPase subunit 6,proteasome subunit p42
  • Gene Pathway
  • RSS
  • YouTube
  • Linkedin
  • Facebook