PSMB10 monoclonal antibody (M01), clone 3F8
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
Western Blot (Cell lysate)
PSMB10 monoclonal antibody (M01), clone 3F8 Western Blot analysis of PSMB10 expression in Jurkat ( Cat # L017V1 ).
Sandwich ELISA (Recombinant protein)
Detection limit for recombinant GST tagged PSMB10 is approximately 3ng/ml as a capture antibody.
Immunofluorescence
Immunofluorescence of monoclonal antibody to PSMB10 on HeLa cell. [antibody concentration 10 ug/ml]
Western Blot detection against Immunogen (55.77 KDa) .
-
Specification
Product Description
Mouse monoclonal antibody raised against a full length recombinant PSMB10.
Immunogen
PSMB10 (AAH17198, 1 a.a. ~ 273 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Sequence
MLKPALEPRGGFSFENCQRNASLERVLPGLKVPHARKTGTTIAGLVFQDGVILGADTRATNDSVVADKSCEKIHFIAPKIYCCGAGVAADAEMTTRMVASKMELHALSTGREPRVATVTRILRQTLFRYQGHVGASLIVGGVDLTGPQLYGVHPHGSYSRLPFTALGSGQDAALAVLEDRFQPNMTLEAAQGLLVEAVTAGILGDLGSGGNVDACVITKTGAKLLRTLSSPTEPVKRSGRYHFVPGTTAVLTQTVKPLTLELVEETVQAMEVE
Host
Mouse
Reactivity
Human
Interspecies Antigen Sequence
Mouse (89); Rat (88)
Isotype
IgG1 Kappa
Quality Control Testing
Antibody Reactive Against Recombinant Protein.
Western Blot detection against Immunogen (55.77 KDa) .
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Cell lysate)
PSMB10 monoclonal antibody (M01), clone 3F8 Western Blot analysis of PSMB10 expression in Jurkat ( Cat # L017V1 ).Western Blot (Recombinant protein)
Sandwich ELISA (Recombinant protein)
Detection limit for recombinant GST tagged PSMB10 is approximately 3ng/ml as a capture antibody.ELISA
Immunofluorescence
Immunofluorescence of monoclonal antibody to PSMB10 on HeLa cell. [antibody concentration 10 ug/ml] -
Gene Info — PSMB10
Entrez GeneID
5699GeneBank Accession#
BC017198Protein Accession#
AAH17198Gene Name
PSMB10
Gene Alias
LMP10, MECL1, MGC1665, beta2i
Gene Description
proteasome (prosome, macropain) subunit, beta type, 10
Omim ID
176847Gene Ontology
HyperlinkGene Summary
The proteasome is a multicatalytic proteinase complex with a highly ordered ring-shaped 20S core structure. The core structure is composed of 4 rings of 28 non-identical subunits; 2 rings are composed of 7 alpha subunits and 2 rings are composed of 7 beta subunits. Proteasomes are distributed throughout eukaryotic cells at a high concentration and cleave peptides in an ATP/ubiquitin-dependent process in a non-lysosomal pathway. An essential function of a modified proteasome, the immunoproteasome, is the processing of class I MHC peptides. This gene encodes a member of the proteasome B-type family, also known as the T1B family, that is a 20S core beta subunit. Proteolytic processing is required to generate a mature subunit. Expression of this gene is induced by gamma interferon, and this gene product replaces catalytic subunit 2 (proteasome beta 7 subunit) in the immunoproteasome. [provided by RefSeq
Other Designations
macropain subunit MECl-1|multicatalytic endopeptidase complex subunit MECl-1|proteasome MECl-1|proteasome beta 10 subunit|proteasome catalytic subunit 2i|proteasome subunit MECL1|proteasome subunit beta 7i
-
Interactome
-
Pathway
-
Disease
-
Publication Reference
-
Endoplasmic reticulum stress activates autophagy but not the proteasome in neuronal cells: implications for Alzheimer's disease.
Nijholt DA, de Graaf TR, van Haastert ES, Oliveira AO, Berkers CR, Zwart R, Ovaa H, Baas F, Hoozemans JJ, Scheper W.
Cell Death and Differentiation 2011 Jun; 18(6):1071.
Application：WB, IHC, Human, SK-N-SH neuroblastoma.
-
Endoplasmic reticulum stress activates autophagy but not the proteasome in neuronal cells: implications for Alzheimer's disease.
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com