PSMB9 polyclonal antibody (A01)
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
-
Specification
Product Description
Mouse polyclonal antibody raised against a full-length recombinant PSMB9.
Immunogen
PSMB9 (AAH65513, 1 a.a. ~ 219 a.a) full-length recombinant protein with GST tag.
Sequence
MLRAGAPTGDLPRAGEVHTGTTIMAVEFDGGVVMGSDSRVSAGEAVVNRVFDKLSPLHERIYCALSGSAADAQAVADMAAYQLELHGIELEEPPLVLAAANVVRNISYKYREDLSAHLMVAGWDQREGGQVYGTLGGMLTRQPFAIGGSGSTFIYGYVDAAYKPGMSPEECRRFTTDAIALAMSRDGSSGGVIYLVTITAAGVDHRVILGNELPKFYDE
Host
Mouse
Reactivity
Human
Interspecies Antigen Sequence
Mouse (88); Rat (90)
Quality Control Testing
Antibody Reactive Against Recombinant Protein.
Western Blot detection against Immunogen (50.2 KDa) .
Storage Buffer
50 % glycerol
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Recombinant protein)
ELISA
-
Gene Info — PSMB9
Entrez GeneID
5698GeneBank Accession#
BC065513Protein Accession#
AAH65513Gene Name
PSMB9
Gene Alias
LMP2, MGC70470, PSMB6i, RING12, beta1i
Gene Description
proteasome (prosome, macropain) subunit, beta type, 9 (large multifunctional peptidase 2)
Omim ID
177045Gene Ontology
HyperlinkGene Summary
The proteasome is a multicatalytic proteinase complex with a highly ordered ring-shaped 20S core structure. The core structure is composed of 4 rings of 28 non-identical subunits; 2 rings are composed of 7 alpha subunits and 2 rings are composed of 7 beta subunits. Proteasomes are distributed throughout eukaryotic cells at a high concentration and cleave peptides in an ATP/ubiquitin-dependent process in a non-lysosomal pathway. An essential function of a modified proteasome, the immunoproteasome, is the processing of class I MHC peptides. This gene encodes a member of the proteasome B-type family, also known as the T1B family, that is a 20S core beta subunit. This gene is located in the class II region of the MHC (major histocompatibility complex). Expression of this gene is induced by gamma interferon and this gene product replaces catalytic subunit 1 (proteasome beta 6 subunit) in the immunoproteasome. Proteolytic processing is required to generate a mature subunit. Two alternative transcripts encoding different isoforms have been identified; both isoforms are processed to yield the same mature subunit. [provided by RefSeq
Other Designations
OTTHUMP00000029423|OTTHUMP00000062982|low molecular mass protein 2|macropain chain 7|multicatalytic endopeptidase complex chain 7|proteasome beta 9 subunit|proteasome catalytic subunit 1i|proteasome chain 7|proteasome subunit beta 6i|proteasome-related ge
-
Interactome
-
Pathway
-
Disease
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com