PSMA6 purified MaxPab mouse polyclonal antibody (B01P)
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
Western Blot (Tissue lysate)
PSMA6 MaxPab polyclonal antibody. Western Blot analysis of PSMA6 expression in human liver.
Western Blot (Transfected lysate)
Western Blot analysis of PSMA6 expression in transfected 293T cell line (H00005687-T01) by PSMA6 MaxPab polyclonal antibody.
Lane 1: PSMA6 transfected lysate(27.06 KDa).
Lane 2: Non-transfected lysate.
Immunofluorescence
Immunofluorescence of purified MaxPab antibody to PSMA6 on HeLa cell. [antibody concentration 10 ug/ml]
-
Specification
Product Description
Mouse polyclonal antibody raised against a full-length human PSMA6 protein.
Immunogen
PSMA6 (NP_002782.1, 1 a.a. ~ 246 a.a) full-length human protein.
Sequence
MSRGSSAGFDRHITIFSPEGRLYQVEYAFKAINQGGLTSVAVRGKDCAVIVTQKKVPDKLLDSSTVTHLFKITENIGCVMTGMTADSRSQVQRARYEAANWKYKYGYEIPVDMLCKRIADISQVYTQNAEMRPLGCCMILIGIDEEQGPQVYKCDPAGYYCGFKATAAGVKQTESTSFLEKKVKKKFDWTFEQTVETAITCLSTVLSIDFKPSEIEVGVVTVENPKFRILTEAEIDAHLVALAERD
Host
Mouse
Reactivity
Human
Quality Control Testing
Antibody reactive against mammalian transfected lysate.
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Tissue lysate)
PSMA6 MaxPab polyclonal antibody. Western Blot analysis of PSMA6 expression in human liver.Western Blot (Transfected lysate)
Western Blot analysis of PSMA6 expression in transfected 293T cell line (H00005687-T01) by PSMA6 MaxPab polyclonal antibody.
Lane 1: PSMA6 transfected lysate(27.06 KDa).
Lane 2: Non-transfected lysate.
Immunofluorescence
Immunofluorescence of purified MaxPab antibody to PSMA6 on HeLa cell. [antibody concentration 10 ug/ml] -
Gene Info — PSMA6
Entrez GeneID
5687GeneBank Accession#
NM_002791.1Protein Accession#
NP_002782.1Gene Name
PSMA6
Gene Alias
IOTA, MGC22756, MGC2333, MGC23846, PROS27, p27K
Gene Description
proteasome (prosome, macropain) subunit, alpha type, 6
Omim ID
602855Gene Ontology
HyperlinkGene Summary
The proteasome is a multicatalytic proteinase complex with a highly ordered ring-shaped 20S core structure. The core structure is composed of 4 rings of 28 non-identical subunits; 2 rings are composed of 7 alpha subunits and 2 rings are composed of 7 beta subunits. Proteasomes are distributed throughout eukaryotic cells at a high concentration and cleave peptides in an ATP/ubiquitin-dependent process in a non-lysosomal pathway. An essential function of a modified proteasome, the immunoproteasome, is the processing of class I MHC peptides. This gene encodes a member of the peptidase T1A family, that is a 20S core alpha subunit. A pseudogene has been identified on the Y chromosome. [provided by RefSeq
Other Designations
27 kDa prosomal protein|OTTHUMP00000178843|macropain iota chain|macropain subunit iota|multicatalytic endopeptidase complex iota chain|prosomal P27K protein|proteasome alpha 6 subunit|proteasome iota chain|proteasome subunit iota
-
Interactome
-
Pathway
-
Disease
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com