Product Browser

Last updated: 2017/11/19
  • Related Product Showcase
  • By Research Area

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

PSMA5 polyclonal antibody (A01)

  • Catalog # : H00005686-A01
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Mouse polyclonal antibody raised against a partial recombinant PSMA5.
  • Immunogen:
  • PSMA5 (NP_002781, 132 a.a. ~ 241 a.a) partial recombinant protein with GST tag.
  • Sequence:
  • AMSRPFGVALLFGGVDEKGPQLFHMDPSGTFVQCDARAIGSASEGAQSSLQEVYHKSMTLKEAIKSSLIILKQVMEEKLNATNIELATVQPGQNFHMFTKEELEEVIKDI
  • Host:
  • Mouse
  • Reactivity:
  • Human
  • Quality Control Testing:
  • Antibody Reactive Against Recombinant Protein.

    QC Testing of H00005686-A01
    Western Blot detection against Immunogen (38.21 KDa) .
  • Storage Buffer:
  • 50 % glycerol
  • Storage Instruction:
  • Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
  • Applications
  • Western Blot (Cell lysate)
  • Western Blot (Cell lysate)
  • PSMA5 polyclonal antibody (A01), Lot # 051108JC01 Western Blot analysis of PSMA5 expression in 293 ( Cat # L026V1 ).
  • PDF DownloadProtocol Download
  • ELISA
  • Application Image
  • Western Blot (Cell lysate)
  • Western Blot (Cell lysate)
  • enlarge
  • Western Blot (Recombinant protein)
  • ELISA
  • Gene Information
  • Entrez GeneID:
  • 5686
  • Gene Name:
  • PSMA5
  • Gene Alias:
  • MGC117302,MGC125802,MGC125803,MGC125804,PSC5,ZETA
  • Gene Description:
  • proteasome (prosome, macropain) subunit, alpha type, 5
  • Gene Summary:
  • The proteasome is a multicatalytic proteinase complex with a highly ordered ring-shaped 20S core structure. The core structure is composed of 4 rings of 28 non-identical subunits; 2 rings are composed of 7 alpha subunits and 2 rings are composed of 7 beta subunits. Proteasomes are distributed throughout eukaryotic cells at a high concentration and cleave peptides in an ATP/ubiquitin-dependent process in a non-lysosomal pathway. An essential function of a modified proteasome, the immunoproteasome, is the processing of class I MHC peptides. This gene encodes a member of the peptidase T1A family, that is a 20S core alpha subunit. [provided by RefSeq
  • Other Designations:
  • OTTHUMP00000013792,macropain subunit zeta,macropain zeta chain,multicatalytic endopeptidase complex zeta chain,proteasome alpha 5 subunit,proteasome component 5,proteasome subunit zeta,proteasome zeta chain
  • Gene Pathway
  • RSS
  • YouTube
  • Linkedin
  • Facebook