PSMA5 polyclonal antibody (A01)
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
Western Blot (Cell lysate)
PSMA5 polyclonal antibody (A01), Lot # 051108JC01 Western Blot analysis of PSMA5 expression in 293 ( Cat # L026V1 ).
Western Blot detection against Immunogen (38.21 KDa) .
-
Specification
Product Description
Mouse polyclonal antibody raised against a partial recombinant PSMA5.
Immunogen
PSMA5 (NP_002781, 132 a.a. ~ 241 a.a) partial recombinant protein with GST tag.
Sequence
AMSRPFGVALLFGGVDEKGPQLFHMDPSGTFVQCDARAIGSASEGAQSSLQEVYHKSMTLKEAIKSSLIILKQVMEEKLNATNIELATVQPGQNFHMFTKEELEEVIKDI
Host
Mouse
Reactivity
Human
Quality Control Testing
Antibody Reactive Against Recombinant Protein.
Western Blot detection against Immunogen (38.21 KDa) .
Storage Buffer
50 % glycerol
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Cell lysate)
PSMA5 polyclonal antibody (A01), Lot # 051108JC01 Western Blot analysis of PSMA5 expression in 293 ( Cat # L026V1 ).Western Blot (Recombinant protein)
ELISA
-
Gene Info — PSMA5
Entrez GeneID
5686GeneBank Accession#
NM_002790Protein Accession#
NP_002781Gene Name
PSMA5
Gene Alias
MGC117302, MGC125802, MGC125803, MGC125804, PSC5, ZETA
Gene Description
proteasome (prosome, macropain) subunit, alpha type, 5
Omim ID
176844Gene Ontology
HyperlinkGene Summary
The proteasome is a multicatalytic proteinase complex with a highly ordered ring-shaped 20S core structure. The core structure is composed of 4 rings of 28 non-identical subunits; 2 rings are composed of 7 alpha subunits and 2 rings are composed of 7 beta subunits. Proteasomes are distributed throughout eukaryotic cells at a high concentration and cleave peptides in an ATP/ubiquitin-dependent process in a non-lysosomal pathway. An essential function of a modified proteasome, the immunoproteasome, is the processing of class I MHC peptides. This gene encodes a member of the peptidase T1A family, that is a 20S core alpha subunit. [provided by RefSeq
Other Designations
OTTHUMP00000013792|macropain subunit zeta|macropain zeta chain|multicatalytic endopeptidase complex zeta chain|proteasome alpha 5 subunit|proteasome component 5|proteasome subunit zeta|proteasome zeta chain
-
Interactome
-
Pathway
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com