KLK10 monoclonal antibody (M01), clone 1G8
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
-
Specification
Product Description
Mouse monoclonal antibody raised against a partial recombinant KLK10.
Immunogen
KLK10 (NP_002767, 167 a.a. ~ 276 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Sequence
DQCQVAGWGTTAARRVKYNKGLTCSSITILSPKECEVFYPGVVTNNMICAGLDRGQDPCQSDSGGPLVCDETLQGILSWGVYPCGSAQHPAVYTQICKYMSWINKVIRSN
Host
Mouse
Reactivity
Human
Isotype
IgG1 lambda
Quality Control Testing
Antibody Reactive Against Recombinant Protein.
Western Blot detection against Immunogen (37.84 KDa) .
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Cell lysate)
KLK10 monoclonal antibody (M01), clone 1G8 Western Blot analysis of KLK10 expression in A-431( Cat # L015V1 ).Western Blot (Recombinant protein)
Sandwich ELISA (Recombinant protein)
Detection limit for recombinant GST tagged KLK10 is approximately 1ng/ml as a capture antibody.ELISA
Immunofluorescence
Immunofluorescence of monoclonal antibody to KLK10 on A-431 cell. [antibody concentration 10 ug/ml] -
Gene Info — KLK10
Entrez GeneID
5655GeneBank Accession#
NM_002776Protein Accession#
NP_002767Gene Name
KLK10
Gene Alias
NES1, PRSSL1
Gene Description
kallikrein-related peptidase 10
Omim ID
602673Gene Ontology
HyperlinkGene Summary
Kallikreins are a subgroup of serine proteases having diverse physiological functions. Growing evidence suggests that many kallikreins are implicated in carcinogenesis and some have potential as novel cancer and other disease biomarkers. This gene is one of the fifteen kallikrein subfamily members located in a cluster on chromosome 19. Its encoded protein is secreted and may play a role in suppression of tumorigenesis in breast and prostate cancers. Alternate splicing of this gene results in multiple transcript variants encoding the same protein. [provided by RefSeq
Other Designations
breast normal epithelial cell associated serine protease|kallikrein 10|normal epithelial cell-specific 1|protease, serine-like, 1
-
Interactome
-
Disease
-
Publication Reference
-
Kallikreins Stepwise Scoring Reveals Three Subtypes of Papillary Thyroid Cancer with Prognostic Implications.
Buj R, Mallona I, Díez-Villanueva A, Zafón C, Mate JL, Roca M, Puig-Domingo M, Reverter JL, Mauricio D, Peinado MA, Jordà M.
Thyroid 2018 May; 28(5):601.
Application:IHC-P, Human, Thyroid.
-
Kallikreins Stepwise Scoring Reveals Three Subtypes of Papillary Thyroid Cancer with Prognostic Implications.
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com