KLK10 polyclonal antibody (A01)
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
Western Blot (Cell lysate)
KLK10 polyclonal antibody (A01), Lot # 051011JC01. Western Blot analysis of KLK10 expression in Raw 264.7.
Western Blot (Cell lysate)
KLK10 polyclonal antibody (A01), Lot # 051011JC01 Western Blot analysis of KLK10 expression in A-431 ( Cat # L015V1 ).
Western Blot (Cell lysate)
KLK10 polyclonal antibody (A01), Lot # 051011JC01. Western Blot analysis of KLK10 expression in NIH/3T3.
Western Blot detection against Immunogen (38.21 KDa) .
-
Specification
Product Description
Mouse polyclonal antibody raised against a partial recombinant KLK10.
Immunogen
KLK10 (NP_002767, 167 a.a. ~ 276 a.a) partial recombinant protein with GST tag.
Sequence
DQCQVAGWGTTAARRVKYNKGLTCSSITILSPKECEVFYPGVVTNNMICAGLDRGQDPCQSDSGGPLVCDETLQGILSWGVYPCGSAQHPAVYTQICKYMSWINKVIRSN
Host
Mouse
Reactivity
Human, Mouse
Quality Control Testing
Antibody Reactive Against Recombinant Protein.
Western Blot detection against Immunogen (38.21 KDa) .
Storage Buffer
50 % glycerol
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Cell lysate)
KLK10 polyclonal antibody (A01), Lot # 051011JC01. Western Blot analysis of KLK10 expression in Raw 264.7.Western Blot (Cell lysate)
KLK10 polyclonal antibody (A01), Lot # 051011JC01 Western Blot analysis of KLK10 expression in A-431 ( Cat # L015V1 ).Western Blot (Cell lysate)
KLK10 polyclonal antibody (A01), Lot # 051011JC01. Western Blot analysis of KLK10 expression in NIH/3T3.Western Blot (Recombinant protein)
ELISA
-
Gene Info — KLK10
Entrez GeneID
5655GeneBank Accession#
NM_002776Protein Accession#
NP_002767Gene Name
KLK10
Gene Alias
NES1, PRSSL1
Gene Description
kallikrein-related peptidase 10
Omim ID
602673Gene Ontology
HyperlinkGene Summary
Kallikreins are a subgroup of serine proteases having diverse physiological functions. Growing evidence suggests that many kallikreins are implicated in carcinogenesis and some have potential as novel cancer and other disease biomarkers. This gene is one of the fifteen kallikrein subfamily members located in a cluster on chromosome 19. Its encoded protein is secreted and may play a role in suppression of tumorigenesis in breast and prostate cancers. Alternate splicing of this gene results in multiple transcript variants encoding the same protein. [provided by RefSeq
Other Designations
breast normal epithelial cell associated serine protease|kallikrein 10|normal epithelial cell-specific 1|protease, serine-like, 1
-
Interactome
-
Disease
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com