KLK6 (Human) Recombinant Protein (Q01)
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
-
Specification
Product Description
Human KLK6 partial ORF ( AAH15525, 91 a.a. - 190 a.a.) recombinant protein with GST-tag at N-terminal.
Sequence
RAVIHPDYDAASHDQDIMLLRLARPAKLSELIQPLPLERDCSANTTSCHILGWGKTADGDFPDTIQCAYIHLVSREECEHAYPGQITQNMLCAGDEKYGK
Host
Wheat Germ (in vitro)
Theoretical MW (kDa)
36.63
Interspecies Antigen Sequence
Mouse (61); Rat (60)
Preparation Method
Purification
Glutathione Sepharose 4 Fast Flow
Quality Control Testing
12.5% SDS-PAGE Stained with Coomassie Blue.
Storage Buffer
50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Storage Instruction
Store at -80°C. Aliquot to avoid repeated freezing and thawing.
Note
Best use within three months from the date of receipt of this protein.
-
Applications
Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
-
Gene Info — KLK6
Entrez GeneID
5653GeneBank Accession#
BC015525Protein Accession#
AAH15525Gene Name
KLK6
Gene Alias
Bssp, Klk7, MGC9355, NEUROSIN, PRSS18, PRSS9, SP59, ZYME, hK6
Gene Description
kallikrein-related peptidase 6
Omim ID
602652Gene Ontology
HyperlinkGene Summary
Kallikreins are a subgroup of serine proteases having diverse physiological functions. Growing evidence suggests that many kallikreins are implicated in carcinogenesis and some have potential as novel cancer and other disease biomarkers. This gene is one of the fifteen kallikrein subfamily members located in a cluster on chromosome 19. The encoded enzyme is regulated by steroid hormones. In tissue culture, the enzyme has been found to generate amyloidogenic fragments from the amyloid precursor protein, suggesting a potential for involvement in Alzheimer's disease. Multiple alternatively spliced transcript variants that encode different isoforms have been identified for this gene. [provided by RefSeq
Other Designations
kallikrein 6 (neurosin, zyme)|protease M|protease, serine, 18|protease, serine, 9
-
Interactome
-
Disease
-
Publication Reference
-
Kallikrein-related peptidase 6 in Alzheimer's disease and vascular dementia.
Ashby EL, Kehoe PG, Love S.
Brain Research 2010 Dec; 2:1363.
Application:Func, WB-Re, Antibody labelling, Recombinant protein.
-
Kallikrein-related peptidase 6 in Alzheimer's disease and vascular dementia.
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com