KLK6 monoclonal antibody (M01), clone 4A10
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
Western Blot (Transfected lysate)
Western Blot analysis of KLK6 expression in transfected 293T cell line by KLK6 monoclonal antibody (M01), clone 4A10.
Lane 1: KLK6 transfected lysate(26.9 KDa).
Lane 2: Non-transfected lysate.
Sandwich ELISA (Recombinant protein)
Detection limit for recombinant GST tagged KLK6 is approximately 0.3ng/ml as a capture antibody.
Western Blot detection against Immunogen (36.63 KDa) .
-
Specification
Product Description
Mouse monoclonal antibody raised against a partial recombinant KLK6.
Immunogen
KLK6 (AAH15525, 91 a.a. ~ 190 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Sequence
RAVIHPDYDAASHDQDIMLLRLARPAKLSELIQPLPLERDCSANTTSCHILGWGKTADGDFPDTIQCAYIHLVSREECEHAYPGQITQNMLCAGDEKYGK
Host
Mouse
Reactivity
Human
Interspecies Antigen Sequence
Mouse (61); Rat (60)
Isotype
IgG2a Kappa
Quality Control Testing
Antibody Reactive Against Recombinant Protein.
Western Blot detection against Immunogen (36.63 KDa) .
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Transfected lysate)
Western Blot analysis of KLK6 expression in transfected 293T cell line by KLK6 monoclonal antibody (M01), clone 4A10.
Lane 1: KLK6 transfected lysate(26.9 KDa).
Lane 2: Non-transfected lysate.
Western Blot (Recombinant protein)
Sandwich ELISA (Recombinant protein)
Detection limit for recombinant GST tagged KLK6 is approximately 0.3ng/ml as a capture antibody.ELISA
-
Gene Info — KLK6
Entrez GeneID
5653GeneBank Accession#
BC015525Protein Accession#
AAH15525Gene Name
KLK6
Gene Alias
Bssp, Klk7, MGC9355, NEUROSIN, PRSS18, PRSS9, SP59, ZYME, hK6
Gene Description
kallikrein-related peptidase 6
Omim ID
602652Gene Ontology
HyperlinkGene Summary
Kallikreins are a subgroup of serine proteases having diverse physiological functions. Growing evidence suggests that many kallikreins are implicated in carcinogenesis and some have potential as novel cancer and other disease biomarkers. This gene is one of the fifteen kallikrein subfamily members located in a cluster on chromosome 19. The encoded enzyme is regulated by steroid hormones. In tissue culture, the enzyme has been found to generate amyloidogenic fragments from the amyloid precursor protein, suggesting a potential for involvement in Alzheimer's disease. Multiple alternatively spliced transcript variants that encode different isoforms have been identified for this gene. [provided by RefSeq
Other Designations
kallikrein 6 (neurosin, zyme)|protease M|protease, serine, 18|protease, serine, 9
-
Interactome
-
Disease
-
Publication Reference
-
Correlation between KLK6 expression and the clinicopathological features of glioma.
Lou J, Si H, Chen Y, Sun X, Zhang H, Niu A, Hu C.
Contemporary Oncology (Poznań, Poland) 2014 Aug; 18(4):246.
Application：IHC, Human, U251 cells.
-
Correlation between KLK6 expression and the clinicopathological features of glioma.
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com