Product Browser

Last updated: 2016/12/4

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

PRSS3 (Human) Recombinant Protein (P01)

  • Catalog # : H00005646-P01
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Human PRSS3 full-length ORF ( NP_002762.2, 1 a.a. - 247 a.a.) recombinant protein with GST-tag at N-terminal.
  • Sequence:
  • MNPFLILAFVGAAVAVPFDDDDKIVGGYTCEENSLPYQVSLNSGSHFCGGSLISEQWVVSAAHCYKTRIQVRLGEHNIKVLEGNEQFINAAKIIRHPKYNRDTLDNDIMLIKLSSPAVINARVSTISLPTAPPAAGTECLISGWGNTLSFGADYPDELKCLDAPVLTQAECKASYPGKITNSMFCVGFLEGGKDSCQRDSGGPVVCNGQLQGVVSWGHGCAWKNRPGVYTKVYNYVDWIKDTIAANS
  • Host:
  • Wheat Germ (in vitro)
  • Theoretical MW (kDa):
  • 53.1
  • Purification:
  • Glutathione Sepharose 4 Fast Flow
  • Quality Control Testing:
  • 12.5% SDS-PAGE Stained with Coomassie Blue.

    QC Testing of H00005646-P01
  • Storage Buffer:
  • 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
  • Storage Instruction:
  • Store at -80°C. Aliquot to avoid repeated freezing and thawing.
  • Note:
  • Best use within three months from the date of receipt of this protein.
  • Applications
  • Enzyme-linked Immunoabsorbent Assay
  • Western Blot (Recombinant protein)
  • Antibody Production
  • Protein Array
  • Application Image
  • Enzyme-linked Immunoabsorbent Assay
  • Western Blot (Recombinant protein)
  • Antibody Production
  • Protein Array
  • Gene Information
  • Entrez GeneID:
  • 5646
  • Gene Name:
  • PRSS3
  • Gene Alias:
  • MTG,PRSS4,TRY3,TRY4
  • Gene Description:
  • protease, serine, 3
  • Gene Summary:
  • This gene encodes a trypsinogen, which is a member of the trypsin family of serine proteases. This enzyme is expressed in the brain and pancreas and is resistant to common trypsin inhibitors. It is active on peptide linkages involving the carboxyl group of lysine or arginine. This gene is localized to the locus of T cell receptor beta variable orphans on chromosome 9. Two transcript variants encoding different isoforms have been described for this gene. [provided by RefSeq
  • Other Designations:
  • OTTHUMP00000045395,brain trypsinogen,mesotrypsin,mesotrypsinogen,pancreatic trypsinogen III,protease, serine, 4 (trypsin 4, brain),trypsin 3,trypsinogen 4,trypsinogen 5,trypsinogen IV
  • RSS
  • YouTube
  • Linkedin
  • Facebook