Product Browser

Last updated: 2017/12/10

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

PRSS2 (Human) Recombinant Protein (P01)

  • Catalog # : H00005645-P01
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Human PRSS2 full-length ORF ( NP_002761.1, 1 a.a. - 247 a.a.) recombinant protein with GST-tag at N-terminal.
  • Sequence:
  • MNLLLILTFVAAAVAAPFDDDDKIVGGYICEENSVPYQVSLNSGYHFCGGSLISEQWVVSAGHCYKSRIQVRLGEHNIEVLEGNEQFINAAKIIRHPKYNSRTLDNDILLIKLSSPAVINSRVSAISLPTAPPAAGTESLISGWGNTLSSGADYPDELQCLDAPVLSQAECEASYPGKITNNMFCVGFLEGGKDSCQGDSGGPVVSNGELQGIVSWGYGCAQKNRPGVYTKVYNYVDWIKDTIAANS
  • Host:
  • Wheat Germ (in vitro)
  • Theoretical MW (kDa):
  • 52.9
  • Purification:
  • Glutathione Sepharose 4 Fast Flow
  • Quality Control Testing:
  • 12.5% SDS-PAGE Stained with Coomassie Blue.

    QC Testing of H00005645-P01
  • Storage Buffer:
  • 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
  • Storage Instruction:
  • Store at -80°C. Aliquot to avoid repeated freezing and thawing.
  • Note:
  • Best use within three months from the date of receipt of this protein.
  • Applications
  • Enzyme-linked Immunoabsorbent Assay
  • Western Blot (Recombinant protein)
  • Antibody Production
  • Protein Array
  • Application Image
  • Enzyme-linked Immunoabsorbent Assay
  • Western Blot (Recombinant protein)
  • Antibody Production
  • Protein Array
  • Gene Information
  • Entrez GeneID:
  • 5645
  • Gene Name:
  • PRSS2
  • Gene Alias:
  • MGC111183,MGC120174,TRY2,TRY8,TRYP2
  • Gene Description:
  • protease, serine, 2 (trypsin 2)
  • Gene Summary:
  • This gene encodes a trypsinogen, which is a member of the trypsin family of serine proteases. This enzyme is secreted by the pancreas and cleaved to its active form in the small intestine. It is active on peptide linkages involving the carboxyl group of lysine or arginine. This gene and several other trypsinogen genes are localized to the T cell receptor beta locus on chromosome 7. [provided by RefSeq
  • Other Designations:
  • anionic trypsinogen,protease serine 2 preproprotein,protease, serine, 2,protease, serine, 2, preproprotein,trypsin 2,trypsin II,trypsinogen 2
  • RSS
  • YouTube
  • Linkedin
  • Facebook