Product Browser

Last updated: 2016/12/4
  • Related Product Showcase
  • By Disease

  • By Antibody/Protein

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

PRSS2 purified MaxPab rabbit polyclonal antibody (D01P)MaxPab

  • Catalog # : H00005645-D01P
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Rabbit polyclonal antibody raised against a full-length human PRSS2 protein.
  • Immunogen:
  • PRSS2 (NP_002761.1, 1 a.a. ~ 247 a.a) full-length human protein.
  • Sequence:
  • MNLLLILTFVAAAVAAPFDDDDKIVGGYICEENSVPYQVSLNSGYHFCGGSLISEQWVVSAGHCYKSRIQVRLGEHNIEVLEGNEQFINAAKIIRHPKYNSRTLDNDILLIKLSSPAVINSRVSAISLPTAPPAAGTESLISGWGNTLSSGADYPDELQCLDAPVLSQAECEASYPGKITNNMFCVGFLEGGKDSCQGDSGGPVVSNGELQGIVSWGYGCAQKNRPGVYTKVYNYVDWIKDTIAANS
  • Host:
  • Rabbit
  • Reactivity:
  • Human
  • Quality Control Testing:
  • Antibody reactive against mammalian transfected lysate.
  • Storage Buffer:
  • In 1x PBS, pH 7.4
  • Storage Instruction:
  • Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
  • Applications
  • Western Blot (Tissue lysate)
  • Western Blot (Tissue lysate)
  • PRSS2 MaxPab rabbit polyclonal antibody. Western Blot analysis of PRSS2 expression in human pancreas.
  • PDF DownloadProtocol Download
  • Western Blot (Transfected lysate)
  • Western Blot (Transfected lysate)
  • Western Blot analysis of PRSS2 expression in transfected 293T cell line (H00005645-T03) by PRSS2 MaxPab polyclonal antibody.

    Lane 1: PRSS2 transfected lysate(26.50 KDa).
    Lane 2: Non-transfected lysate.
  • PDF DownloadProtocol Download
  • Application Image
  • Western Blot (Tissue lysate)
  • Western Blot (Tissue lysate)
  • enlarge
  • Western Blot (Transfected lysate)
  • Western Blot (Transfected lysate)
  • enlarge
  • Gene Information
  • Entrez GeneID:
  • 5645
  • Gene Name:
  • PRSS2
  • Gene Alias:
  • MGC111183,MGC120174,TRY2,TRY8,TRYP2
  • Gene Description:
  • protease, serine, 2 (trypsin 2)
  • Gene Summary:
  • This gene encodes a trypsinogen, which is a member of the trypsin family of serine proteases. This enzyme is secreted by the pancreas and cleaved to its active form in the small intestine. It is active on peptide linkages involving the carboxyl group of lysine or arginine. This gene and several other trypsinogen genes are localized to the T cell receptor beta locus on chromosome 7. [provided by RefSeq
  • Other Designations:
  • anionic trypsinogen,protease serine 2 preproprotein,protease, serine, 2,protease, serine, 2, preproprotein,trypsin 2,trypsin II,trypsinogen 2
  • RSS
  • YouTube
  • Linkedin
  • Facebook