Product Browser

Last updated: 2016/12/4

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

PRODH (Human) Recombinant Protein (Q01)

  • Catalog # : H00005625-Q01
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Human PRODH partial ORF ( NP_057419, 441 a.a. - 540 a.a.) recombinant protein with GST-tag at N-terminal.
  • Sequence:
  • LVRGAYLAQERARAAEIGYEDPINPTYEATNAMYHRCLDYVLEELKHNAKAKVMVASHNEDTVRFALRRMEELGLHPADHRVYFGQLLGMCDQISFPLGQ
  • Host:
  • Wheat Germ (in vitro)
  • Theoretical MW (kDa):
  • 36.74
  • Purification:
  • Glutathione Sepharose 4 Fast Flow
  • Quality Control Testing:
  • 12.5% SDS-PAGE Stained with Coomassie Blue.

    QC Testing of H00005625-Q01
  • Storage Buffer:
  • 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
  • Storage Instruction:
  • Store at -80°C. Aliquot to avoid repeated freezing and thawing.
  • Note:
  • Best use within three months from the date of receipt of this protein.
  • Applications
  • Enzyme-linked Immunoabsorbent Assay
  • Western Blot (Recombinant protein)
  • Antibody Production
  • Protein Array
  • Application Image
  • Enzyme-linked Immunoabsorbent Assay
  • Western Blot (Recombinant protein)
  • Antibody Production
  • Protein Array
  • Gene Information
  • Entrez GeneID:
  • 5625
  • Gene Name:
  • PRODH
  • Gene Alias:
  • FLJ33744,HSPOX2,MGC148078,MGC148079,PIG6,POX,PRODH1,PRODH2,SCZD4,TP53I6
  • Gene Description:
  • proline dehydrogenase (oxidase) 1
  • Gene Summary:
  • The protein encoded by this gene is a mitochondrial proline dehydrogenase that catalyzes the first step in proline degradation. Defects in this gene are a cause of hyperprolinemia type 1 and possibly susceptibility to schizophrenia 4 (SCZD4). The gene is located on chromosome 22q11.21, a region which has also been associated with the contiguous gene deletion syndromes DiGeorge syndrome and CATCH22 syndrome. [provided by RefSeq
  • Other Designations:
  • OTTHUMP00000196495,proline dehydrogenase 1,proline oxidase 2,proline oxidase, mitochondrial,tumor protein p53 inducible protein 6
  • RSS
  • YouTube
  • Linkedin
  • Facebook