Product Browser

Last updated: 2017/5/21
  • Related Product Showcase

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

MAP2K1 polyclonal antibody (A01)

  • Catalog # : H00005604-A01
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Mouse polyclonal antibody raised against a partial recombinant MAP2K1.
  • Immunogen:
  • MAP2K1 (NP_002746, 294 a.a. ~ 393 a.a) partial recombinant protein with GST tag.
  • Sequence:
  • GRPLSSYGMDSRPPMAIFELLDYIVNEPPPKLPSGVFSLEFQDFVNKCLIKNPAERADLKQLMVHAFIKRSDAEEVDFAGWLCSTIGLNQPSTPTHAAGV
  • Host:
  • Mouse
  • Reactivity:
  • Human
  • Quality Control Testing:
  • Antibody Reactive Against Recombinant Protein.
  • Storage Buffer:
  • 50 % glycerol
  • Storage Instruction:
  • Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
  • Applications
  • ELISA
  • Application Image
  • ELISA
  • Gene Information
  • Entrez GeneID:
  • 5604
  • Gene Name:
  • MAP2K1
  • Gene Alias:
  • MAPKK1,MEK1,MKK1,PRKMK1
  • Gene Description:
  • mitogen-activated protein kinase kinase 1
  • Gene Summary:
  • The protein encoded by this gene is a member of the dual specificity protein kinase family, which acts as a mitogen-activated protein (MAP) kinase kinase. MAP kinases, also known as extracellular signal-regulated kinases (ERKs), act as an integration point for multiple biochemical signals. This protein kinase lies upstream of MAP kinases and stimulates the enzymatic activity of MAP kinases upon wide variety of extra- and intracellular signals. As an essential component of MAP kinase signal transduction pathway, this kinase is involved in many cellular processes such as proliferation, differentiation, transcription regulation and development. [provided by RefSeq
  • Other Designations:
  • protein kinase, mitogen-activated, kinase 1 (MAP kinase kinase 1)
  • RSS
  • YouTube
  • Linkedin
  • Facebook