MAPK13 (Human) Recombinant Protein (P01)
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
-
Specification
Product Description
Human MAPK13 full-length ORF ( AAH00433.1, 1 a.a. - 365 a.a.) recombinant protein with GST-tag at N-terminal.
Sequence
MSLIRKKGFYKQDVNKTAWELPKTYVSPTHVGSGAYGSVCSAIDKRSGEKVAIKKLSRPFQSEIFAKRAYRELLLLKHMQHENVIGLLDVFTPASSLRNFYDFYLVMPFMQTDLQKIMGMEFSEEKIQYLVYQMLKGLKYIHSAGVVHRDLKPGNLAVNEDCELKILDFGLARHADAEMTGYVVTRWYRAPEVILSWMHYNQTVDIWSVGCIMAEMLTGKTLFKGKDYLDQLTQILKVTGVPGTEFVQKLNDKAAKSYIQSLPQTPRKDFTQLFPRASPQAADLLEKMLELDVDKRLTAAQALTHPFFEPFRDPEEETEAQQPFDDSLEHEKLTVDEWKQHIYKEIVNFSPIARKDSRRRSGMKL
Host
Wheat Germ (in vitro)
Theoretical MW (kDa)
65.78
Preparation Method
Purification
Glutathione Sepharose 4 Fast Flow
Quality Control Testing
12.5% SDS-PAGE Stained with Coomassie Blue.
Storage Buffer
50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Storage Instruction
Store at -80°C. Aliquot to avoid repeated freezing and thawing.
Note
Best use within three months from the date of receipt of this protein.
-
Applications
Kinase Assay
Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
-
Gene Info — MAPK13
Entrez GeneID
5603GeneBank Accession#
BC000433Protein Accession#
AAH00433.1Gene Name
MAPK13
Gene Alias
MGC99536, PRKM13, SAPK4, p38delta
Gene Description
mitogen-activated protein kinase 13
Omim ID
602899Gene Ontology
HyperlinkGene Summary
The protein encoded by this gene is a member of the MAP kinase family. MAP kinases act as an integration point for multiple biochemical signals, and are involved in a wide variety of cellular processes such as proliferation, differentiation, transcription regulation and development. This kinase is closely related to p38 MAP kinase, both of which can be activated by proinflammatory cytokines and cellular stress. MAP kinase kinases 3, and 6 can phosphorylate and activate this kinase. Transcription factor ATF2, and microtubule dynamics regulator stathmin have been shown to be the substrates of this kinase. [provided by RefSeq
Other Designations
OTTHUMP00000016282|mitogen-activated protein kinase p38 delta|stress-activated protein kinase 4
-
Interactome
-
Pathway
- Amyotrophic lateral sclerosis (ALS)
- Epithelial cell signaling in Helicobacter pylori infection
- Fc epsilon RI signaling pathway
- GnRH signaling pathway
- Leukocyte transendothelial migration
- MAPK signaling pathway
- Neurotrophin signaling pathway
- T cell receptor signaling pathway
- Toll-like receptor signaling pathway
+ View More Disease
-
Disease
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com