MAPK13 monoclonal antibody (M04), clone 1E6
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
-
Specification
Product Description
Mouse monoclonal antibody raised against a partial recombinant MAPK13.
Immunogen
MAPK13 (AAH00433, 251 a.a. ~ 365 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Sequence
NDKAAKSYIQSLPQTPRKDFTQLFPRASPQAADLLEKMLELDVDRRLTAAQALTHPFFEPFRDPEEETEAQQPFDDSLEHEKLTVDEWKQHIYKEIVNFSPIARKDSRRRSGMKL
Host
Mouse
Reactivity
Human
Isotype
IgG1 Kappa
Quality Control Testing
Antibody Reactive Against Recombinant Protein.
Western Blot detection against Immunogen (38.28 KDa) .
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Cell lysate)
MAPK13 monoclonal antibody (M04), clone 1E6 Western Blot analysis of MAPK13 expression in HepG2 ( Cat # L019V1 ).Western Blot (Recombinant protein)
Sandwich ELISA (Recombinant protein)
Detection limit for recombinant GST tagged MAPK13 is 0.3 ng/ml as a capture antibody.ELISA
-
Gene Info — MAPK13
Entrez GeneID
5603GeneBank Accession#
BC000433Protein Accession#
AAH00433Gene Name
MAPK13
Gene Alias
MGC99536, PRKM13, SAPK4, p38delta
Gene Description
mitogen-activated protein kinase 13
Omim ID
602899Gene Ontology
HyperlinkGene Summary
The protein encoded by this gene is a member of the MAP kinase family. MAP kinases act as an integration point for multiple biochemical signals, and are involved in a wide variety of cellular processes such as proliferation, differentiation, transcription regulation and development. This kinase is closely related to p38 MAP kinase, both of which can be activated by proinflammatory cytokines and cellular stress. MAP kinase kinases 3, and 6 can phosphorylate and activate this kinase. Transcription factor ATF2, and microtubule dynamics regulator stathmin have been shown to be the substrates of this kinase. [provided by RefSeq
Other Designations
OTTHUMP00000016282|mitogen-activated protein kinase p38 delta|stress-activated protein kinase 4
-
Interactome
-
Pathway
- Amyotrophic lateral sclerosis (ALS)
- Epithelial cell signaling in Helicobacter pylori infection
- Fc epsilon RI signaling pathway
- GnRH signaling pathway
- Leukocyte transendothelial migration
- MAPK signaling pathway
- Neurotrophin signaling pathway
- T cell receptor signaling pathway
- Toll-like receptor signaling pathway
+ View More Disease
-
Disease
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com