MAPK11 MaxPab rabbit polyclonal antibody (D01)
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
Western Blot (Transfected lysate)
Western Blot analysis of MAPK11 expression in transfected 293T cell line (H00005600-T02) by MAPK11 MaxPab polyclonal antibody.
Lane 1: MAPK11 transfected lysate(41.4 KDa).
Lane 2: Non-transfected lysate.
Immunoprecipitation
Immunoprecipitation of MAPK11 transfected lysate using anti-MAPK11 MaxPab rabbit polyclonal antibody and Protein A Magnetic Bead, and immunoblotted with MAPK11 purified MaxPab mouse polyclonal antibody (B01P) (H00005600-B01P).
-
Specification
Product Description
Rabbit polyclonal antibody raised against a full-length human MAPK11 protein.
Immunogen
MAPK11 (NP_002742.3, 1 a.a. ~ 364 a.a) full-length human protein.
Sequence
MSGPRAGFYRQELNKTVWEVPQRLQGLRPVGSGAYGSVCSAYDARLRQKVAVKKLSRPFQSLIHARRTYRELRLLKHLKHENVIGLLDVFTPATSIEDFSEVYLVTTLMGADLNNIVKCQALSDEHVQFLVYQLLRGLKYIHSAGIIHRDLKPSNVAVNEDCELRILDFGLARQADEEMTGYVATRWYRAPEIMLNWMHYNQTVDIWSVGCIMAELLQGKALFPGSDYIDQLKRIMEVVGTPSPEVLAKISSEHARTYIQSLPPMPQKDLSSIFRGANPLAIDLLGRMLVLDSDQRVSAAEALAHAYFSQYHDPEDEPEAEPYDESVEAKERTLEEWKELTYQEVLSFKPPEPPKPPGSLEIEQ
Host
Rabbit
Reactivity
Human
Quality Control Testing
Antibody reactive against mammalian transfected lysate.
Storage Buffer
No additive
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Transfected lysate)
Western Blot analysis of MAPK11 expression in transfected 293T cell line (H00005600-T02) by MAPK11 MaxPab polyclonal antibody.
Lane 1: MAPK11 transfected lysate(41.4 KDa).
Lane 2: Non-transfected lysate.
Immunoprecipitation
Immunoprecipitation of MAPK11 transfected lysate using anti-MAPK11 MaxPab rabbit polyclonal antibody and Protein A Magnetic Bead, and immunoblotted with MAPK11 purified MaxPab mouse polyclonal antibody (B01P) (H00005600-B01P). -
Gene Info — MAPK11
Entrez GeneID
5600GeneBank Accession#
NM_002751.5Protein Accession#
NP_002742.3Gene Name
MAPK11
Gene Alias
P38B, P38BETA2, PRKM11, SAPK2, SAPK2B, p38-2, p38Beta
Gene Description
mitogen-activated protein kinase 11
Omim ID
602898Gene Ontology
HyperlinkGene Summary
The protein encoded by this gene is a member of the MAP kinase family. MAP kinases act as an integration point for multiple biochemical signals, and are involved in a wide variety of cellular processes such as proliferation, differentiation, transcription regulation, and development. This kinase is most closely related to p38 MAP kinase, both of which can be activated by proinflammatory cytokines and environmental stress. This kinase is activated through its phosphorylation by MAP kinase kinases (MKKs), preferably by MKK6. Transcription factor ATF2/CREB2 has been shown to be a substrate of this kinase. [provided by RefSeq
Other Designations
OTTHUMP00000196655|mitogen-activated protein kinase p38 beta|mitogen-activated protein kinase p38-2|stress-activated protein kinase-2|stress-activated protein kinase-2b
-
Interactome
-
Pathway
- Amyotrophic lateral sclerosis (ALS)
- Epithelial cell signaling in Helicobacter pylori infection
- Fc epsilon RI signaling pathway
- GnRH signaling pathway
- Leukocyte transendothelial migration
- MAPK signaling pathway
- Neurotrophin signaling pathway
- T cell receptor signaling pathway
- Toll-like receptor signaling pathway
+ View More Disease
-
Disease
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com