Product Browser

Last updated: 2016/11/27
  • Related Product Showcase

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

MAPK1 polyclonal antibody (A01)

  • Catalog # : H00005594-A01
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Mouse polyclonal antibody raised against a partial recombinant MAPK1.
  • Immunogen:
  • MAPK1 (AAH17832, 261 a.a. ~ 360 a.a) partial recombinant protein with GST tag.
  • Sequence:
  • RNYLLSLPHKNKVPWNRLFPNADSKALDLLDKMLTFNPHKRIEVEQALAHPYLEQYYDPSDEPIAEAPFKFDMELDDLPKEKLKELIFEETARFQPGYRS
  • Host:
  • Mouse
  • Reactivity:
  • Human
  • Quality Control Testing:
  • Antibody Reactive Against Recombinant Protein.
  • Storage Buffer:
  • 50 % glycerol
  • Storage Instruction:
  • Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
  • Applications
  • ELISA
  • Application Image
  • ELISA
  • Gene Information
  • Entrez GeneID:
  • 5594
  • Gene Name:
  • MAPK1
  • Gene Alias:
  • ERK,ERK2,ERT1,MAPK2,P42MAPK,PRKM1,PRKM2,p38,p40,p41,p41mapk
  • Gene Description:
  • mitogen-activated protein kinase 1
  • Gene Summary:
  • The protein encoded by this gene is a member of the MAP kinase family. MAP kinases, also known as extracellular signal-regulated kinases (ERKs), act as an integration point for multiple biochemical signals, and are involved in a wide variety of cellular processes such as proliferation, differentiation, transcription regulation and development. The activation of this kinase requires its phosphorylation by upstream kinases. Upon activation, this kinase translocates to the nucleus of the stimulated cells, where it phosphorylates nuclear targets. Two alternatively spliced transcript variants encoding the same protein, but differing in the UTRs, have been reported for this gene. [provided by RefSeq
  • Other Designations:
  • OTTHUMP00000174492,extracellular signal-regulated kinase 2,extracellular signal-regulated kinase-2,mitogen-activated protein kinase 2,protein tyrosine kinase ERK2
  • RSS
  • YouTube
  • Linkedin
  • Facebook