PRKCG polyclonal antibody (A01)
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
-
Specification
Product Description
Mouse polyclonal antibody raised against a partial recombinant PRKCG.
Immunogen
PRKCG (AAH47876, 260 a.a. ~ 351 a.a) partial recombinant protein with GST tag.
Sequence
SFGVSELLKAPVDGWYKLLNQEEGEYYNVPVADADNCSLLQKFEACNYPLELYERVRMGPSSSPIPSPSPSPTDPKRCFFGASPGRLHISDF
Host
Mouse
Reactivity
Human
Interspecies Antigen Sequence
Mouse (99); Rat (99)
Quality Control Testing
Antibody Reactive Against Recombinant Protein.
Western Blot detection against Immunogen (36.12 KDa) .
Storage Buffer
50 % glycerol
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Cell lysate)
PRKCG polyclonal antibody (A01), Lot # 051122JC01 Western Blot analysis of PRKCG expression in Jurkat ( Cat # L017V1 ).Western Blot (Recombinant protein)
ELISA
-
Gene Info — PRKCG
Entrez GeneID
5582GeneBank Accession#
BC047876Protein Accession#
AAH47876Gene Name
PRKCG
Gene Alias
MGC57564, PKC-gamma, PKCC, PKCG, SCA14
Gene Description
protein kinase C, gamma
Gene Ontology
HyperlinkGene Summary
Protein kinase C (PKC) is a family of serine- and threonine-specific protein kinases that can be activated by calcium and second messenger diacylglycerol. PKC family members phosphorylate a wide variety of protein targets and are known to be involved in diverse cellular signaling pathways. PKC also serve as major receptors for phorbol esters, a class of tumor promoters. Each member of the PKC family has a specific expression profile and is believed to play distinct roles in cells. The protein encoded by this gene is one of the PKC family members. This protein kinase is expressed solely in the brain and spinal cord and its localization is restricted to neurons. It has been demonstrated that several neuronal functions, including long term potentiation (LTP) and long term depression (LTD), specifically require this kinase. Knockout studies in mice also suggest that this kinase may be involved in neuropathic pain development. Defects in this protein have been associated with neurodegenerative disorder spinocerebellar ataxia-14 (SCA14). [provided by RefSeq
Other Designations
-
-
Interactome
-
Pathway
-
Disease
-
Publication Reference
-
Downregulation of protein kinase C gamma reduces epithelial property and enhances malignant phenotypes in colorectal cancer cells.
Reiko Satow, Yudai Suzuki, Shinobu Asada, Sae Ota, Masashi Idogawa, Shiori Kubota, Noi Ikeo, Atsuko Yoneda, Kiyoko Fukami.
iScience 2022 Dec; 25(12):105501.
Application:IHC-P, WB-Ce, WB-Tr, Human, CaCo-2, DLD-1, HCT116, LoVo, SW480, SW620, WiDr cells.
-
Downregulation of protein kinase C gamma reduces epithelial property and enhances malignant phenotypes in colorectal cancer cells.
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com