PRKCE polyclonal antibody (A01)
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
-
Specification
Product Description
Mouse polyclonal antibody raised against a partial recombinant PRKCE.
Immunogen
PRKCE (NP_005391, 301 a.a. ~ 400 a.a) partial recombinant protein with GST tag.
Sequence
KVLADLGVTPDKITNSGQRRKKLIAGAESPQPASGSSPSEEDRSKSAPTSPCDQEIKELENNIRKALSFDNRGEEHRAASSPDGQLMSPGENGEVRQGQA
Host
Mouse
Reactivity
Human, Mouse
Interspecies Antigen Sequence
Mouse (91)
Quality Control Testing
Antibody Reactive Against Recombinant Protein.
Western Blot detection against Immunogen (37.11 KDa) .
Storage Buffer
50 % glycerol
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Cell lysate)
PRKCE polyclonal antibody (A01), Lot # 051024JC01 Western Blot analysis of PRKCE expression in NIH/3T3 ( Cat # L018V1 ).Western Blot (Recombinant protein)
ELISA
-
Gene Info — PRKCE
Entrez GeneID
5581GeneBank Accession#
NM_005400Protein Accession#
NP_005391Gene Name
PRKCE
Gene Alias
MGC125656, MGC125657, PKCE, nPKC-epsilon
Gene Description
protein kinase C, epsilon
Omim ID
176975Gene Ontology
HyperlinkGene Summary
Protein kinase C (PKC) is a family of serine- and threonine-specific protein kinases that can be activated by calcium and the second messenger diacylglycerol. PKC family members phosphorylate a wide variety of protein targets and are known to be involved in diverse cellular signaling pathways. PKC family members also serve as major receptors for phorbol esters, a class of tumor promoters. Each member of the PKC family has a specific expression profile and is believed to play a distinct role in cells. The protein encoded by this gene is one of the PKC family members. This kinase has been shown to be involved in many different cellular functions, such as neuron channel activation, apoptosis, cardioprotection from ischemia, heat shock response, as well as insulin exocytosis. Knockout studies in mice suggest that this kinase is important for lipopolysaccharide (LPS)-mediated signaling in activated macrophages and may also play a role in controlling anxiety-like behavior. [provided by RefSeq
Other Designations
-
-
Interactome
-
Pathway
-
Disease
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com