PRKAR1B monoclonal antibody (M05), clone 1F8
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
Western Blot (Cell lysate)
PRKAR1B monoclonal antibody (M05), clone 1F8 Western Blot analysis of PRKAR1B expression in HepG2 ( Cat # L019V1 ).
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
Immunoperoxidase of monoclonal antibody to PRKAR1B on formalin-fixed paraffin-embedded human stomach. [antibody concentration 3 ug/ml]
Sandwich ELISA (Recombinant protein)
Detection limit for recombinant GST tagged PRKAR1B is 0.03 ng/ml as a capture antibody.
Western Blot detection against Immunogen (36.01 KDa) .
-
Specification
Product Description
Mouse monoclonal antibody raised against a partial recombinant PRKAR1B.
Immunogen
PRKAR1B (NP_002726, 1 a.a. ~ 90 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Sequence
MASPPACPSEEDESLKGCELYVQLHGIQQVLKDCIVHLCISKPERPMKFLREHFEKLEKEENRQILARQKSNSQSDSHDEEVSPTPPNPV
Host
Mouse
Reactivity
Human
Isotype
IgG2a Kappa
Quality Control Testing
Antibody Reactive Against Recombinant Protein.
Western Blot detection against Immunogen (36.01 KDa) .
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Cell lysate)
PRKAR1B monoclonal antibody (M05), clone 1F8 Western Blot analysis of PRKAR1B expression in HepG2 ( Cat # L019V1 ).Western Blot (Recombinant protein)
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
Immunoperoxidase of monoclonal antibody to PRKAR1B on formalin-fixed paraffin-embedded human stomach. [antibody concentration 3 ug/ml]Sandwich ELISA (Recombinant protein)
Detection limit for recombinant GST tagged PRKAR1B is 0.03 ng/ml as a capture antibody.ELISA
-
Gene Info — PRKAR1B
Entrez GeneID
5575GeneBank Accession#
NM_002735Protein Accession#
NP_002726Gene Name
PRKAR1B
Gene Alias
PRKAR1
Gene Description
protein kinase, cAMP-dependent, regulatory, type I, beta
Omim ID
176911Gene Ontology
HyperlinkGene Summary
Cyclic AMP-dependent protein kinase A (PKA) is an essential enzyme in the signaling pathway of the second messenger cAMP. Through phosphorylation of target proteins, PKA controls many biochemical events in the cell including regulation of metabolism, ion transport, and gene transcription. The PKA holoenzyme is composed of 2 regulatory and 2 catalytic subunits and dissociates from the regulatory subunits upon binding of cAMP.[supplied by OMIM
Other Designations
-
-
Interactome
-
Pathway
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com