Product Browser

Last updated: 2017/11/12
  • Related Product Showcase

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

PRKACB polyclonal antibody (A01)

  • Catalog # : H00005567-A01
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Mouse polyclonal antibody raised against a full-length recombinant PRKACB.
  • Immunogen:
  • PRKACB (AAH16285, 1 a.a. ~ 257 a.a) full-length recombinant protein with GST tag.
  • Sequence:
  • MGNAATAKKGSEVESVKEFLAKAKEDFLKKWENPTQNNAGLEDFERKKTLGTGSFGRVMLVKHKATEQYYAMKILDKQKVVKLKQIEHTLNEKRILQAVNFPFLVRLEYAFKDNSNLYMVMEYVPGGEMFSHLRRIGRFSEPHARFYAAQIVLTFEYLHSLDLIYRDLKPENLLIDHQGYIQVTDFGFAKRVKGRTWTLCGTPEYLAPEIILSKGYNKAVDWWALGVLIYEMAAGYPPFFADQPIQIYEKIVSGKNF
  • Host:
  • Mouse
  • Reactivity:
  • Human
  • Quality Control Testing:
  • Antibody Reactive Against Recombinant Protein.

    QC Testing of H00005567-A01
    Western Blot detection against Immunogen (54.38 KDa) .
  • Storage Buffer:
  • 50 % glycerol
  • Storage Instruction:
  • Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
  • Applications
  • ELISA
  • Application Image
  • Western Blot (Recombinant protein)
  • ELISA
  • Gene Information
  • Entrez GeneID:
  • 5567
  • Gene Name:
  • PRKACB
  • Gene Alias:
  • DKFZp781I2452,MGC41879,MGC9320,PKACB
  • Gene Description:
  • protein kinase, cAMP-dependent, catalytic, beta
  • Gene Summary:
  • cAMP is a signaling molecule important for a variety of cellular functions. cAMP exerts its effects by activating the cAMP-dependent protein kinase, which transduces the signal through phosphorylation of different target proteins. The inactive kinase holoenzyme is a tetramer composed of two regulatory and two catalytic subunits. cAMP causes the dissociation of the inactive holoenzyme into a dimer of regulatory subunits bound to four cAMP and two free monomeric catalytic subunits. Four different regulatory subunits and three catalytic subunits have been identified in humans. The protein encoded by this gene is a member of the Ser/Thr protein kinase family and is a catalytic subunit of cAMP-dependent protein kinase. Three alternatively spliced transcript variants encoding distinct isoforms have been observed. [provided by RefSeq
  • Other Designations:
  • OTTHUMP00000011663,OTTHUMP00000011664,OTTHUMP00000011666,PKA C-beta,cAMP-dependent protein kinase catalytic beta subunit isoform 4ab,cAMP-dependent protein kinase catalytic subunit beta,protein kinase A catalytic subunit beta
  • RSS
  • YouTube
  • Linkedin
  • Facebook