PRKACA (Human) Recombinant Protein (Q02)
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
-
Specification
Product Description
Human PRKACA partial ORF ( NP_002721, 252 a.a. - 350 a.a.) recombinant protein with GST-tag at N-terminal.
Sequence
VSGKVRFPSHFSSDLKDLLRNLLQVDLTKRFGNLKNGVNDIKNHKWFATTDWIAIYQRKVEAPFIPKFKGPGDTSNFDDYEEEEIRVSINEKCGKEFSE
Host
Wheat Germ (in vitro)
Theoretical MW (kDa)
36.63
Interspecies Antigen Sequence
Mouse (99); Rat (99)
Preparation Method
Purification
Glutathione Sepharose 4 Fast Flow
Quality Control Testing
12.5% SDS-PAGE Stained with Coomassie Blue.
Storage Buffer
50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Storage Instruction
Store at -80°C. Aliquot to avoid repeated freezing and thawing.
Note
Best use within three months from the date of receipt of this protein.
-
Applications
Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
-
Gene Info — PRKACA
Entrez GeneID
5566GeneBank Accession#
NM_002730Protein Accession#
NP_002721Gene Name
PRKACA
Gene Alias
MGC102831, MGC48865, PKACA
Gene Description
protein kinase, cAMP-dependent, catalytic, alpha
Omim ID
601639Gene Ontology
HyperlinkGene Summary
cAMP is a signaling molecule important for a variety of cellular functions. cAMP exerts its effects by activating the cAMP-dependent protein kinase, which transduces the signal through phosphorylation of different target proteins. The inactive kinase holoenzyme is a tetramer composed of two regulatory and two catalytic subunits. cAMP causes the dissociation of the inactive holoenzyme into a dimer of regulatory subunits bound to four cAMP and two free monomeric catalytic subunits. Four different regulatory subunits and three catalytic subunits have been identified in humans. The protein encoded by this gene is a member of the Ser/Thr protein kinase family and is a catalytic subunit of cAMP-dependent protein kinase. Alternatively spliced transcript variants encoding distinct isoforms have been observed. [provided by RefSeq
Other Designations
PKA C-alpha|cAMP-dependent protein kinase catalytic subunit alpha|cAMP-dependent protein kinase catalytic subunit alpha, isoform 1|protein kinase A catalytic subunit
-
Interactome
-
Pathway
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com