PRKAB2 purified MaxPab mouse polyclonal antibody (B01P)
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
Western Blot (Tissue lysate)
PRKAB2 MaxPab polyclonal antibody. Western Blot analysis of PRKAB2 expression in human liver.
Western Blot (Transfected lysate)
Western Blot analysis of PRKAB2 expression in transfected 293T cell line (H00005565-T01) by PRKAB2 MaxPab polyclonal antibody.
Lane 1: PRKAB2 transfected lysate(29.92 KDa).
Lane 2: Non-transfected lysate.
-
Specification
Product Description
Mouse polyclonal antibody raised against a full-length human PRKAB2 protein.
Immunogen
PRKAB2 (NP_005390.1, 1 a.a. ~ 272 a.a) full-length human protein.
Sequence
MGNTTSDRVSGERHGAKAARSEGAGGHAPGKEHKIMVGSTDDPSVFSLPDSKLPGDKEFVSWQQDLEDSVKPTQQARPTVIRWSEGGKEVFISGSFNNWSTKIPLIKSHNDFVAILDLPEGEHQYKFFVDGQWVHDPSEPVVTSQLGTINNLIHVKKSDFEVFDALKLDSMESSETSCRDLSSSPPGPYGQEMYAFRSEERFKSPPILPPHLLQVILNKDTNISCDPALLPEPNHVMLNHLYALSIKDSVMVLSATHRYKKKYVTTLLYKPI
Host
Mouse
Reactivity
Human
Quality Control Testing
Antibody reactive against mammalian transfected lysate.
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Tissue lysate)
PRKAB2 MaxPab polyclonal antibody. Western Blot analysis of PRKAB2 expression in human liver.Western Blot (Transfected lysate)
Western Blot analysis of PRKAB2 expression in transfected 293T cell line (H00005565-T01) by PRKAB2 MaxPab polyclonal antibody.
Lane 1: PRKAB2 transfected lysate(29.92 KDa).
Lane 2: Non-transfected lysate.
-
Gene Info — PRKAB2
Entrez GeneID
5565GeneBank Accession#
NM_005399Protein Accession#
NP_005390.1Gene Name
PRKAB2
Gene Alias
MGC61468
Gene Description
protein kinase, AMP-activated, beta 2 non-catalytic subunit
Omim ID
602741Gene Ontology
HyperlinkGene Summary
The protein encoded by this gene is a regulatory subunit of the AMP-activated protein kinase (AMPK). AMPK is a heterotrimer consisting of an alpha catalytic subunit, and non-catalytic beta and gamma subunits. AMPK is an important energy-sensing enzyme that monitors cellular energy status. In response to cellular metabolic stresses, AMPK is activated, and thus phosphorylates and inactivates acetyl-CoA carboxylase (ACC) and beta-hydroxy beta-methylglutaryl-CoA reductase (HMGCR), key enzymes involved in regulating de novo biosynthesis of fatty acid and cholesterol. This subunit may be a positive regulator of AMPK activity. It is highly expressed in skeletal muscle and thus may have tissue-specific roles. [provided by RefSeq
Other Designations
5'-AMP-activated protein kinase, beta-2 subunit|AMP-activated protein kinase beta 2 non-catalytic subunit|AMPK beta 2|AMPK beta-2 chain|OTTHUMP00000015910
-
Interactome
-
Pathway
-
Disease
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com