PRKAB1 monoclonal antibody (M07), clone 1D3
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
Western Blot (Cell lysate)
PRKAB1 monoclonal antibody (M07), clone 1D3. Western Blot analysis of PRKAB1 expression in Raw 264.7 ( Cat # L024V1 ).
Sandwich ELISA (Recombinant protein)
Detection limit for recombinant GST tagged PRKAB1 is 3 ng/ml as a capture antibody.
Western Blot detection against Immunogen (55.44 KDa) .
-
Specification
Product Description
Mouse monoclonal antibody raised against a full-length recombinant PRKAB1.
Immunogen
PRKAB1 (AAH17671, 1 a.a. ~ 270 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Sequence
MGNTSSERAALERHGGHKTPRRDSSGGTKDGDRPKILMDSPEDADLFHSEEIKAPEKEEFLAWQHDLEVNDKAPAQARPTVFRWTGGGKEVYLSGSFNNWSKLPLTRSHNNFVAILDLPEGEHQYKFFVDGQWTHDPSEPIVTSQLGTVNNIIQVKKTDFEVFDALMVDSQKCSDVSELSSSPPGPYHQEPYVCKPEERFRAPPILPPHLLQVILNKDTGISCDPALLPEPNHVMLNHLYALSIKDGVMVLSATHRYKKKYVTTLLYKPI
Host
Mouse
Reactivity
Human, Mouse
Interspecies Antigen Sequence
Mouse (97)
Isotype
IgG2b Kappa
Quality Control Testing
Antibody Reactive Against Recombinant Protein.
Western Blot detection against Immunogen (55.44 KDa) .
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Cell lysate)
PRKAB1 monoclonal antibody (M07), clone 1D3. Western Blot analysis of PRKAB1 expression in Raw 264.7 ( Cat # L024V1 ).Western Blot (Recombinant protein)
Sandwich ELISA (Recombinant protein)
Detection limit for recombinant GST tagged PRKAB1 is 3 ng/ml as a capture antibody.ELISA
-
Gene Info — PRKAB1
Entrez GeneID
5564GeneBank Accession#
BC017671Protein Accession#
AAH17671Gene Name
PRKAB1
Gene Alias
AMPK, HAMPKb, MGC17785
Gene Description
protein kinase, AMP-activated, beta 1 non-catalytic subunit
Omim ID
602740Gene Ontology
HyperlinkGene Summary
The protein encoded by this gene is a regulatory subunit of the AMP-activated protein kinase (AMPK). AMPK is a heterotrimer consisting of an alpha catalytic subunit, and non-catalytic beta and gamma subunits. AMPK is an important energy-sensing enzyme that monitors cellular energy status. In response to cellular metabolic stresses, AMPK is activated, and thus phosphorylates and inactivates acetyl-CoA carboxylase (ACC) and beta-hydroxy beta-methylglutaryl-CoA reductase (HMGCR), key enzymes involved in regulating de novo biosynthesis of fatty acid and cholesterol. This subunit may be a positive regulator of AMPK activity. The myristoylation and phosphorylation of this subunit have been shown to affect the enzyme activity and cellular localization of AMPK. This subunit may also serve as an adaptor molecule mediating the association of the AMPK complex. [provided by RefSeq
Other Designations
5'-AMP-activated protein kinase beta-1 subunit|AMP-activated protein kinase beta 1 non-catalytic subunit|AMP-activated protein kinase beta subunit|AMPK beta -1 chain|AMPK beta 1|protein kinase, AMP-activated, noncatalytic, beta-1
-
Interactome
-
Pathway
-
Disease
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com