Product Browser

Last updated: 2017/1/22
  • Related Product Showcase

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

PRKAA2 monoclonal antibody (M02), clone 1G8

  • Catalog # : H00005563-M02
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Mouse monoclonal antibody raised against a partial recombinant PRKAA2.
  • Immunogen:
  • PRKAA2 (NP_006243, 453 a.a. ~ 552 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
  • Sequence:
  • MSLQLYLVDNRSYLLDFKSIDDEVVEQRSGSSTPQRSCSAAGLHRPRSSFDSTTAESHSLSGSLTGSLTGSTLSSVSPRLGSHTMDFFEMCASLITTLAR
  • Host:
  • Mouse
  • Reactivity:
  • Human
  • Isotype:
  • IgG2a Kappa
  • Quality Control Testing:
  • Antibody Reactive Against Recombinant Protein.

    QC Testing of H00005563-M02
    Western Blot detection against Immunogen (36.74 KDa) .
  • Storage Buffer:
  • In 1x PBS, pH 7.4
  • Storage Instruction:
  • Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
  • Applications
  • Western Blot (Transfected lysate)
  • Western Blot (Transfected lysate)
  • Western Blot analysis of PRKAA2 expression in transfected 293T cell line by PRKAA2 monoclonal antibody (M02), clone 1G8.

    Lane 1: PRKAA2 transfected lysate(62.3 KDa).
    Lane 2: Non-transfected lysate.
  • PDF DownloadProtocol Download
  • Sandwich ELISA (Recombinant protein)
  • Sandwich ELISA (Recombinant protein)
  • Detection limit for recombinant GST tagged PRKAA2 is approximately 0.03ng/ml as a capture antibody.
  • PDF DownloadProtocol Download
  • ELISA
  • RNAi Knockdown (Antibody validated)
  • RNAi Knockdown (Antibody validated)
  • Western blot analysis of PRKAA2 over-expressed 293 cell line, cotransfected with PRKAA2 Validated Chimera RNAi ( Cat # H00005563-R01V ) (Lane 2) or non-transfected control (Lane 1). Blot probed with PRKAA2 monoclonal antibody (M02) clone 1G8 (Cat # H00005563-M02 ). GAPDH ( 36.1 kDa ) used as specificity and loading control.
  • PDF DownloadProtocol Download
  • In situ Proximity Ligation Assay (Cell)
  • <em>In situ</em> Proximity Ligation Assay (Cell)
  • Proximity Ligation Analysis of protein-protein interactions between STK11 and PRKAA2. HeLa cells were stained with anti-STK11 rabbit purified polyclonal 1:1200 and anti-PRKAA2 mouse monoclonal antibody 1:50. Each red dot represents the detection of protein-protein interaction complex, and nuclei were counterstained with DAPI (blue).
  • Application Image
  • Western Blot (Transfected lysate)
  • Western Blot (Transfected lysate)
  • enlarge
  • Western Blot (Recombinant protein)
  • Sandwich ELISA (Recombinant protein)
  • Sandwich ELISA (Recombinant protein)
  • enlarge
  • ELISA
  • RNAi Knockdown (Antibody validated)
  • RNAi Knockdown (Antibody validated)
  • enlarge
  • In situ Proximity Ligation Assay (Cell)
  • <em>In situ</em> Proximity Ligation Assay (Cell)
  • enlarge
  • Gene Information
  • Entrez GeneID:
  • 5563
  • Gene Name:
  • PRKAA2
  • Gene Alias:
  • AMPK,AMPK2,PRKAA
  • Gene Description:
  • protein kinase, AMP-activated, alpha 2 catalytic subunit
  • Gene Summary:
  • The protein encoded by this gene is a catalytic subunit of the AMP-activated protein kinase (AMPK). AMPK is a heterotrimer consisting of an alpha catalytic subunit, and non-catalytic beta and gamma subunits. AMPK is an important energy-sensing enzyme that monitors cellular energy status. In response to cellular metabolic stresses, AMPK is activated, and thus phosphorylates and inactivates acetyl-CoA carboxylase (ACC) and beta-hydroxy beta-methylglutaryl-CoA reductase (HMGCR), key enzymes involved in regulating de novo biosynthesis of fatty acid and cholesterol. Studies of the mouse counterpart suggest that this catalytic subunit may control whole-body insulin sensitivity and is necessary for maintaining myocardial energy homeostasis during ischemia. [provided by RefSeq
  • Other Designations:
  • 5'-AMP-activated protein kinase, catalytic alpha-2 chain,AMP-activated protein kinase alpha 2 catalytic subunit,AMPK-alpha-2 chain,OTTHUMP00000009993
  • RSS
  • YouTube
  • Linkedin
  • Facebook