PRKAA1 (Human) Recombinant Protein (P01)
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
-
Specification
Product Description
Human PRKAA1 full-length ORF ( AAH12622, 1 a.a. - 207 a.a.) recombinant protein with GST-tag at N-terminal.
Sequence
MATAEKQKHDGRVKIGHYILGDTLGVGTFGKVKVGKHELTGHKVAVKILNRQKIRSLDVVGKIRREIQNLKLFRHPHIIKLYQVISTPSDIFMVMEYVSGGELFDYICKNGRLDEKESRRLFQRILSGVDYCHRHMVVHRDLKPENVLLDAHMNAKIADFGLSNMMSDGEFLRTSCGSPNYAAPEVISGRDCNIIRILTSQFTNYQH
Host
Wheat Germ (in vitro)
Theoretical MW (kDa)
48.51
Preparation Method
Purification
Glutathione Sepharose 4 Fast Flow
Quality Control Testing
12.5% SDS-PAGE Stained with Coomassie Blue.
Storage Buffer
50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Storage Instruction
Store at -80°C. Aliquot to avoid repeated freezing and thawing.
Note
Best use within three months from the date of receipt of this protein.
-
Applications
Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
-
Gene Info — PRKAA1
Entrez GeneID
5562GeneBank Accession#
BC012622Protein Accession#
AAH12622Gene Name
PRKAA1
Gene Alias
AMPK, AMPKa1, MGC33776, MGC57364
Gene Description
protein kinase, AMP-activated, alpha 1 catalytic subunit
Omim ID
602739Gene Ontology
HyperlinkGene Summary
The protein encoded by this gene belongs to the ser/thr protein kinase family. It is the catalytic subunit of the 5'-prime-AMP-activated protein kinase (AMPK). AMPK is a cellular energy sensor conserved in all eukaryotic cells. The kinase activity of AMPK is activated by the stimuli that increase the cellular AMP/ATP ratio. AMPK regulates the activities of a number of key metabolic enzymes through phosphorylation. It protects cells from stresses that cause ATP depletion by switching off ATP-consuming biosynthetic pathways. Alternatively spliced transcript variants encoding distinct isoforms have been observed. [provided by RefSeq
Other Designations
5'-AMP-activated protein kinase, catalytic alpha-1 chain|AMP -activate kinase alpha 1 subunit|AMP-activated protein kinase, catalytic, alpha-1|AMPK alpha 1
-
Interactome
-
Pathway
-
Disease
-
Publication Reference
-
γ-6-Phosphogluconolactone, a Byproduct of the Oxidative Pentose Phosphate Pathway, Contributes to AMPK Activation through Inhibition of PP2A.
Gao X, Zhao L, Liu S, Li Y, Xia S, Chen D, Wang M, Wu S, Dai Q, Vu H, Zacharias L, DeBerardinis R, Lim E, Metallo C, Boggon TJ, Lonial S, Lin R, Mao H, Pan Y, Shan C, Chen J.
Molecular Cell 2019 Dec; 76(6):857.
Application:Func, KA, Human, K-562 cells.
-
γ-6-Phosphogluconolactone, a Byproduct of the Oxidative Pentose Phosphate Pathway, Contributes to AMPK Activation through Inhibition of PP2A.
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com