PRKAA1 monoclonal antibody (M01), clone 1G4
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
Western Blot (Cell lysate)
PRKAA1 monoclonal antibody (M01), clone 1G4 Western Blot analysis of PRKAA1 expression in HepG2 ( Cat # L019V1 ).
Sandwich ELISA (Recombinant protein)
Detection limit for recombinant GST tagged PRKAA1 is approximately 0.3ng/ml as a capture antibody.
Western Blot detection against Immunogen (36.74 KDa) .
-
Specification
Product Description
Mouse monoclonal antibody raised against a partial recombinant PRKAA1.
Immunogen
PRKAA1 (AAH12622, 451 a.a. ~ 550 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Sequence
LQLYQVDSRTYLLDFRSIDDEITEAKSGTATPQRSGSVSNYRSCQRSDSDAEAQGKSSEVSLTSSVTSLDSSPVDLTPRPGSHTIEFFEMCANLIKILAQ
Host
Mouse
Reactivity
Human
Isotype
IgG2a Kappa
Quality Control Testing
Antibody Reactive Against Recombinant Protein.
Western Blot detection against Immunogen (36.74 KDa) .
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Cell lysate)
PRKAA1 monoclonal antibody (M01), clone 1G4 Western Blot analysis of PRKAA1 expression in HepG2 ( Cat # L019V1 ).Western Blot (Recombinant protein)
Sandwich ELISA (Recombinant protein)
Detection limit for recombinant GST tagged PRKAA1 is approximately 0.3ng/ml as a capture antibody.ELISA
-
Gene Info — PRKAA1
Entrez GeneID
5562GeneBank Accession#
NM_006251Protein Accession#
AAH12622Gene Name
PRKAA1
Gene Alias
AMPK, AMPKa1, MGC33776, MGC57364
Gene Description
protein kinase, AMP-activated, alpha 1 catalytic subunit
Omim ID
602739Gene Ontology
HyperlinkGene Summary
The protein encoded by this gene belongs to the ser/thr protein kinase family. It is the catalytic subunit of the 5'-prime-AMP-activated protein kinase (AMPK). AMPK is a cellular energy sensor conserved in all eukaryotic cells. The kinase activity of AMPK is activated by the stimuli that increase the cellular AMP/ATP ratio. AMPK regulates the activities of a number of key metabolic enzymes through phosphorylation. It protects cells from stresses that cause ATP depletion by switching off ATP-consuming biosynthetic pathways. Alternatively spliced transcript variants encoding distinct isoforms have been observed. [provided by RefSeq
Other Designations
5'-AMP-activated protein kinase, catalytic alpha-1 chain|AMP -activate kinase alpha 1 subunit|AMP-activated protein kinase, catalytic, alpha-1|AMPK alpha 1
-
Interactome
-
Pathway
-
Disease
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com