PRH2 monoclonal antibody (M03), clone 1E6
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
Sandwich ELISA (Recombinant protein)
Detection limit for recombinant GST tagged PRH2 is 0.03 ng/ml as a capture antibody.
Western Blot detection against Immunogen (43.4 KDa) .
-
Specification
Product Description
Mouse monoclonal antibody raised against a full-length recombinant PRH2.
Immunogen
PRH2 (NP_005033.1, 1 a.a. ~ 166 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Sequence
MLLILLSVALLAFSSAQDLDEDVSQEDVPLVISDGGDSEQFIDEERQGPPLGGQQSQPSAGDGNQNDGPQQGPPQQGGQQQQGPPPPQGKPQGPPQQGGHPPPPQGRPQGPPQQGGHPRPPRGRPQGPPQQGGHQQGPPPPPPGKPQGPPPQGGRPQGPPQGQSPQ
Host
Mouse
Reactivity
Human
Isotype
IgG2a Kappa
Quality Control Testing
Antibody Reactive Against Recombinant Protein.
Western Blot detection against Immunogen (43.4 KDa) .
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Recombinant protein)
Sandwich ELISA (Recombinant protein)
Detection limit for recombinant GST tagged PRH2 is 0.03 ng/ml as a capture antibody.ELISA
-
Gene Info — PRH2
Entrez GeneID
5555GeneBank Accession#
NM_005042.2Protein Accession#
NP_005033.1Gene Name
PRH2
Gene Alias
DKFZp686B01256, DKFZp686F14256, DKFZp686I11251, DKFZp686J06255, DKFZp686L01253, DKFZp686L16244, DKFZp686M04243, DKFZp686N24248, Pr
Gene Description
proline-rich protein HaeIII subfamily 2
Omim ID
168790Gene Ontology
HyperlinkGene Summary
HaeIII type
Other Designations
acidic salivary proline-rich protein, HaeIII type, 2|parotid proline-rich protein
-
Publication Reference
-
Identification and detection of protein markers to differentiate between forensically relevant body fluids.
de Beijer RP, de Graaf C, van Weert A, van Leeuwen TG, Aalders MCG, van Dam A.
Forensic Science International 2018 Sep; 290:196.
Application：Dot, Human, Blood, Saliva, Semen, Sweat, Urine samples.
-
Identification and detection of protein markers to differentiate between forensically relevant body fluids.
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com