Product Browser

Last updated: 2017/2/26

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

PRG2 (Human) Recombinant Protein (Q01)

  • Catalog # : H00005553-Q01
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Human PRG2 partial ORF ( AAH05929, 123 a.a. - 222 a.a.) recombinant protein with GST-tag at N-terminal.
  • Sequence:
  • FTCRRCYRGNLVSIHNFNINYRIQCSVSALNQGQVWIGGRITGSGRCRRFQWVDGSRWNFAYWAAHQPWSRGGHCVALCTRGGYWRRAHCLRRLPFICSY
  • Host:
  • Wheat Germ (in vitro)
  • Theoretical MW (kDa):
  • 36.74
  • Purification:
  • Glutathione Sepharose 4 Fast Flow
  • Quality Control Testing:
  • 12.5% SDS-PAGE Stained with Coomassie Blue.

    QC Testing of H00005553-Q01
  • Storage Buffer:
  • 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
  • Storage Instruction:
  • Store at -80°C. Aliquot to avoid repeated freezing and thawing.
  • Note:
  • Best use within three months from the date of receipt of this protein.
  • Applications
  • Enzyme-linked Immunoabsorbent Assay
  • Western Blot (Recombinant protein)
  • Antibody Production
  • Protein Array
  • Application Image
  • Enzyme-linked Immunoabsorbent Assay
  • Western Blot (Recombinant protein)
  • Antibody Production
  • Protein Array
  • Gene Information
  • Entrez GeneID:
  • 5553
  • Gene Name:
  • PRG2
  • Gene Alias:
  • BMPG,MBP,MBP1,MGC14537
  • Gene Description:
  • proteoglycan 2, bone marrow (natural killer cell activator, eosinophil granule major basic protein)
  • Gene Summary:
  • The protein encoded by this gene is the predominant constituent of the crystalline core of the eosinophil granule. High levels of the proform of this protein are also present in placenta and pregnancy serum, where it exists as a complex with several other proteins including pregnancy-associated plasma protein A (PAPPA), angiotensinogen (AGT), and C3dg. This protein may be involved in antiparasitic defense mechanisms as a cytotoxin and helminthotoxin, and in immune hypersensitivity reactions. It is directly implicated in epithelial cell damage, exfoliation, and bronchospasm in allergic diseases. [provided by RefSeq
  • Other Designations:
  • bone-marrow proteoglycan,eosinophil granule major basic protein,eosinophil major basic protein,natural killer cell activator,proteoglycan 2,proteoglycan 2 preproprotein
  • Gene Pathway
  • RSS
  • YouTube
  • Linkedin
  • Facebook