Product Browser

Last updated: 2016/12/4
  • Related Product Showcase
  • By Research Area

  • By Disease

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

PRG2 purified MaxPab mouse polyclonal antibody (B01P)MaxPab

  • Catalog # : H00005553-B01P
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Mouse polyclonal antibody raised against a full-length human PRG2 protein.
  • Immunogen:
  • PRG2 (AAH05929.1, 1 a.a. ~ 222 a.a) full-length human protein.
  • Sequence:
  • MKLPLLLALLFGAVSALHLRSETSTFETPLGAKTQPEDEETPEQEMEETPCRELEEEEEWGSGSEDASKKDGAVESISVPDMVDKNLTCPEEEDTVKVVGIPGCQTCRYLLVRSLQTFSQAWFTCRRCYRGNLVSIHNFNINYRIQCSVSALNQGQVWIGGRITGSGRCRRFQWVDGSRWNFAYWAAHQPWSRGGHCVALCTRGGYWRRAHCLRRLPFICSY
  • Host:
  • Mouse
  • Reactivity:
  • Human
  • Quality Control Testing:
  • Antibody reactive against mammalian transfected lysate.
  • Storage Buffer:
  • In 1x PBS, pH 7.4
  • Storage Instruction:
  • Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
  • Applications
  • Western Blot (Transfected lysate)
  • Western Blot (Transfected lysate)
  • Western Blot analysis of PRG2 expression in transfected 293T cell line (H00005553-T01) by PRG2 MaxPab polyclonal antibody.

    Lane 1: PRG2 transfected lysate(24.53 KDa).
    Lane 2: Non-transfected lysate.
  • PDF DownloadProtocol Download
  • Application Image
  • Western Blot (Transfected lysate)
  • Western Blot (Transfected lysate)
  • enlarge
  • Gene Information
  • Entrez GeneID:
  • 5553
  • Gene Name:
  • PRG2
  • Gene Alias:
  • BMPG,MBP,MBP1,MGC14537
  • Gene Description:
  • proteoglycan 2, bone marrow (natural killer cell activator, eosinophil granule major basic protein)
  • Gene Summary:
  • The protein encoded by this gene is the predominant constituent of the crystalline core of the eosinophil granule. High levels of the proform of this protein are also present in placenta and pregnancy serum, where it exists as a complex with several other proteins including pregnancy-associated plasma protein A (PAPPA), angiotensinogen (AGT), and C3dg. This protein may be involved in antiparasitic defense mechanisms as a cytotoxin and helminthotoxin, and in immune hypersensitivity reactions. It is directly implicated in epithelial cell damage, exfoliation, and bronchospasm in allergic diseases. [provided by RefSeq
  • Other Designations:
  • bone-marrow proteoglycan,eosinophil granule major basic protein,eosinophil major basic protein,natural killer cell activator,proteoglycan 2,proteoglycan 2 preproprotein
  • Gene Pathway
  • RSS
  • YouTube
  • Linkedin
  • Facebook