Product Browser

Last updated: 2016/11/27

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

PRG1 (Human) Recombinant Protein (Q01)

  • Catalog # : H00005552-Q01
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Human PRG1 partial ORF ( NP_002718, 29 a.a. - 94 a.a.) recombinant protein with GST-tag at N-terminal.
  • Sequence:
  • PTRRARYQWVRCNPDSNSANCLEEKGPMFELLPGESNKIPRLRTDLFPKTRIQDLNRIFPLSEDYS
  • Host:
  • Wheat Germ (in vitro)
  • Theoretical MW (kDa):
  • 33
  • Purification:
  • Glutathione Sepharose 4 Fast Flow
  • Quality Control Testing:
  • 12.5% SDS-PAGE Stained with Coomassie Blue.

    QC Testing of H00005552-Q01
  • Storage Buffer:
  • 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
  • Storage Instruction:
  • Store at -80°C. Aliquot to avoid repeated freezing and thawing.
  • Note:
  • Best use within three months from the date of receipt of this protein.
  • Applications
  • Enzyme-linked Immunoabsorbent Assay
  • Western Blot (Recombinant protein)
  • Antibody Production
  • Protein Array
  • Application Image
  • Enzyme-linked Immunoabsorbent Assay
  • Western Blot (Recombinant protein)
  • Antibody Production
  • Protein Array
  • Gene Information
  • Entrez GeneID:
  • 5552
  • Gene Name:
  • SRGN
  • Gene Alias:
  • FLJ12930,MGC9289,PPG,PRG,PRG1
  • Gene Description:
  • serglycin
  • Gene Summary:
  • This gene encodes a protein best known as a hematopoietic cell granule proteoglycan. Proteoglycans stored in the secretory granules of many hematopoietic cells also contain a protease-resistant peptide core, which may be important for neutralizing hydrolytic enzymes. This encoded protein was found to be associated with the macromolecular complex of granzymes and perforin, which may serve as a mediator of granule-mediated apoptosis. [provided by RefSeq
  • Other Designations:
  • OTTHUMP00000019716,hematopoetic proteoglycan core peptide,platelet proteoglycan protein core,proteoglycan 1, secretory granule,proteoglycan protein core for mast cell secretory granule,secretory granule proteoglycan 1,secretory granule proteoglycan core p
  • RSS
  • YouTube
  • Linkedin
  • Facebook