SRGN monoclonal antibody (M03), clone 1D8
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
-
Specification
Product Description
Mouse monoclonal antibody raised against a full-length recombinant SRGN.
Immunogen
SRGN (AAH15516, 1 a.a. ~ 158 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Sequence
MMQKLLKCSRLVLALALILVLESSVQGYPTQRARYQWVRCNPDSNSANCLEEKGPMFELLPGESNKIPRLRTDLFPKTRIQDLNRIFPLSEDYSGSGFGSGSGSGSGSGSGFLTEMEQDYQLVDESDAFHDNLRSLDRNLPSDSQDLGQHGLEEDFML
Host
Mouse
Reactivity
Human
Isotype
IgG2a Kappa
Quality Control Testing
Antibody Reactive Against Recombinant Protein.
Western Blot detection against Immunogen (43.12 KDa) .
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Recombinant protein)
Sandwich ELISA (Recombinant protein)
Detection limit for recombinant GST tagged SRGN is 0.3 ng/ml as a capture antibody.ELISA
-
Gene Info — SRGN
Entrez GeneID
5552GeneBank Accession#
BC015516Protein Accession#
AAH15516Gene Name
SRGN
Gene Alias
FLJ12930, MGC9289, PPG, PRG, PRG1
Gene Description
serglycin
Omim ID
177040Gene Ontology
HyperlinkGene Summary
This gene encodes a protein best known as a hematopoietic cell granule proteoglycan. Proteoglycans stored in the secretory granules of many hematopoietic cells also contain a protease-resistant peptide core, which may be important for neutralizing hydrolytic enzymes. This encoded protein was found to be associated with the macromolecular complex of granzymes and perforin, which may serve as a mediator of granule-mediated apoptosis. [provided by RefSeq
Other Designations
OTTHUMP00000019716|hematopoetic proteoglycan core peptide|platelet proteoglycan protein core|proteoglycan 1, secretory granule|proteoglycan protein core for mast cell secretory granule|secretory granule proteoglycan 1|secretory granule proteoglycan core p
-
Interactome
-
Publication Reference
-
Serglycin secretion is part of the inflammatory response in activated primary human endothelial cells in vitro.
Reine TM, Vuong TT, Jenssen TG, Kolset SO.
Biochimica et Biophysica Acta 2014 Aug; 1840(8):2498.
Application:IP, Human, HUVECs.
-
Changes in glycosaminoglycan structure on differentiation of human embryonic stem cells towards mesoderm and endoderm lineages.
Gasimli L, Hickey AM, Yang B, Li G, dela Rosa M, Nairn AV, Kulik MJ, Dordick JS, Moremen KW, Dalton S, Linhardt RJ.
Biochimica et Biophysica Acta 2014 Jun; 1840(6):1993.
Application:WB, Human, hESC H9 cells.
-
Serglycin is a theranostic target in nasopharyngeal carcinoma that promotes metastasis.
Li XJ, Ong CK, Cao Y, Xiang Y, Shao JY, Ooi A, Peng LX, Lu WH, Zhang Z, Petillo D, Qin L, Bao YN, Zheng FJ, Chia CS, Iyer NG, Kang TB, Zeng YX, Soo KC, Trent JM, Teh BT, Qian CN.
Cancer Research 2011 Apr; 71(8):3162.
Application:IHC, WB, Human, NPC tissue, CNE-2, S26, S18 cells.
-
Serglycin secretion is part of the inflammatory response in activated primary human endothelial cells in vitro.
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com