PRF1 monoclonal antibody (M04), clone 3B4
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
-
Specification
Product Description
Mouse monoclonal antibody raised against a partial recombinant PRF1.
Immunogen
PRF1 (NP_005032.2, 461 a.a. ~ 555 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Sequence
WSVRLDFGDVLLATGGPLRLQVWDQDSGRDDDLLGTCDQAPKSGSHEVRCNLNHGHLKFRYHARCLPHLGGGTCLDYVPQMLLGEPPGNRSGAVW
Host
Mouse
Reactivity
Human
Interspecies Antigen Sequence
Mouse (72); Rat (74)
Isotype
IgG2a Kappa
Quality Control Testing
Antibody Reactive Against Recombinant Protein.
Western Blot detection against Immunogen (36.19 KDa) .
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Transfected lysate)
Western Blot analysis of PRF1 expression in transfected 293T cell line by PRF1 monoclonal antibody (M04), clone 3B4.
Lane 1: PRF1 transfected lysate(61.4 KDa).
Lane 2: Non-transfected lysate.
Western Blot (Recombinant protein)
Immunoprecipitation
Immunoprecipitation of PRF1 transfected lysate using anti-PRF1 monoclonal antibody and Protein A Magnetic Bead, and immunoblotted with PRF1 MaxPab rabbit polyclonal antibody.Sandwich ELISA (Recombinant protein)
Detection limit for recombinant GST tagged PRF1 is 0.1 ng/ml as a capture antibody.ELISA
-
Gene Info — PRF1
Entrez GeneID
5551GeneBank Accession#
NM_005041Protein Accession#
NP_005032.2Gene Name
PRF1
Gene Alias
FLH2, HPLH2, MGC65093, P1, PFN1, PFP
Gene Description
perforin 1 (pore forming protein)
Gene Ontology
HyperlinkGene Summary
The protein encoded by this gene has structural and functional similarities to complement component 9 (C9). Like C9, this protein creates transmembrane tubules and is capable of lysing non-specifically a variety of target cells. This protein is one of the main cytolytic proteins of cytolytic granules, and it is known to be a key effector molecule for T-cell- and natural killer-cell-mediated cytolysis. Defects in this gene cause familial hemophagocytic lymphohistiocytosis type 2 (HPLH2), a rare and lethal autosomal recessive disorder of early childhood. Alternative splicing results in multiple transcript variants encoding the same protein. [provided by RefSeq
Other Designations
OTTHUMP00000019759|cytolysin|lymphocyte pore forming protein|perforin 1
-
Interactome
-
Pathway
-
Disease
-
Publication Reference
-
Overexpressed perforin contributes to the melanocyte destruction via epigenetic regulation in patients with vitiligo.
Qiancheng Deng, Puyu Zou, Pei Du, Yaqian Shi, Zixin Pi, Yangfan Xiao, Takuro Kanekura, Huiming Zhang, Yi Zhan, Xiangning Qiu, Yan Ding, Zhuotong Zeng, Rong Xiao.
International Immunopharmacology 2023 Jan; 114:109574.
Application:IHC, Human, Human skin.
-
Overexpressed perforin contributes to the melanocyte destruction via epigenetic regulation in patients with vitiligo.
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com