PRELP (Human) Recombinant Protein (Q01)
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
-
Specification
Product Description
Human PRELP partial ORF ( NP_002716.1, 281 a.a. - 365 a.a.) recombinant protein with GST-tag at N-terminal.
Sequence
RGLPKNSFNISNLLVLHLSHNRISSVPAINNRLEHLYLNNNSIEKINGTQICPNDLVAFHDFSSDLENVPHLRYLRLDGNYLKPP
Host
Wheat Germ (in vitro)
Theoretical MW (kDa)
35.09
Interspecies Antigen Sequence
Mouse (93); Rat (92)
Preparation Method
Purification
Glutathione Sepharose 4 Fast Flow
Quality Control Testing
12.5% SDS-PAGE Stained with Coomassie Blue.
Storage Buffer
50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Storage Instruction
Store at -80°C. Aliquot to avoid repeated freezing and thawing.
Note
Best use within three months from the date of receipt of this protein.
-
Applications
Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
-
Gene Info — PRELP
Entrez GeneID
5549GeneBank Accession#
NM_002725Protein Accession#
NP_002716.1Gene Name
PRELP
Gene Alias
MGC45323, MST161, MSTP161, SLRR2A
Gene Description
proline/arginine-rich end leucine-rich repeat protein
Omim ID
601914Gene Ontology
HyperlinkGene Summary
The protein encoded by this gene is a leucine-rich repeat protein present in connective tissue extracellular matrix. This protein functions as a molecule anchoring basement membranes to the underlying connective tissue. This protein has been shown to bind type I collagen to basement membranes and type II collagen to cartilage. It also binds the basement membrane heparan sulfate proteoglycan perlecan. This protein is suggested to be involved in the pathogenesis of Hutchinson-Gilford progeria (HGP), which is reported to lack the binding of collagen in basement membranes and cartilage. Alternatively spliced transcript variants encoding the same protein have been observed. [provided by RefSeq
Other Designations
55 kDa leucine-rich repeat protein of articular cartilage|OTTHUMP00000034099|prolargin proteoglycan|proline arginine-rich end leucine-rich repeat protein
-
Interactome
-
Disease
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com