PRB3 (Human) Recombinant Protein (P01)
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
-
Specification
Product Description
Human PRB3 full-length ORF ( AAH96212.1, 1 a.a. - 162 a.a.) recombinant protein with GST-tag at N-terminal.
Sequence
MLLILLSVALLALSSAQSLNEDVSQEESPSVISGKPEGRRPQGGNQPQRTPPPPGKPEGRPPQGGNQSQGPPPRPGKPEGQPPQGGNKPQGPPPHPGKPQGPPPQEGNKPQRPPPPGRPQGPPPPGGNPQQPLPPPAGKPQGPPPPPQGGRPHRPPQGQPPQ
Host
Wheat Germ (in vitro)
Theoretical MW (kDa)
43
Preparation Method
Purification
Glutathione Sepharose 4 Fast Flow
Quality Control Testing
12.5% SDS-PAGE Stained with Coomassie Blue.
Storage Buffer
50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Storage Instruction
Store at -80°C. Aliquot to avoid repeated freezing and thawing.
Note
Best use within three months from the date of receipt of this protein.
-
Applications
Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
-
Gene Info — PRB3
Entrez GeneID
5544GeneBank Accession#
BC096212.3Protein Accession#
AAH96212.1Gene Name
PRB3
Gene Alias
G1, MGC116862, MGC116863, MGC116864, PRG
Gene Description
proline-rich protein BstNI subfamily 3
Omim ID
168840Gene Ontology
HyperlinkGene Summary
The protein encoded by this gene is a proline-rich salivary protein. It is a major constituent of parotid saliva. This protein is proposed to act as a bacterial receptor. This gene and five other genes that also encode salivary proline-rich proteins (PRPs), as well as a gene encoding a lacrimal gland PRP, form a PRP gene cluster in the chromosomal 12p13 region. [provided by RefSeq
Other Designations
BstNI type basic salivary proline-rich protein 3|G1 parotid salivary glycoprotein|proline-rich protein BstNI, subfamily-3
-
Interactome
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com