Product Browser

Last updated: 2016/12/4
  • Related Product Showcase

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

PPP3R2 polyclonal antibody (A01)

  • Catalog # : H00005535-A01
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Mouse polyclonal antibody raised against a partial recombinant PPP3R2.
  • Immunogen:
  • PPP3R2 (NP_671709, 1 a.a. ~ 110 a.a) partial recombinant protein with GST tag.
  • Sequence:
  • MSTMGNEASYPAEMCSHFDNDEIKRLGRRFKKLDLDKSGSLSVEEFMSLPELRHNPLVRRVIDVFDTDGDGEVDFKEFILGTSQFSVKGDEEQKLRFAFSIYDMDKDGYI
  • Host:
  • Mouse
  • Reactivity:
  • Human
  • Quality Control Testing:
  • Antibody Reactive Against Recombinant Protein.

    QC Testing of H00005535-A01
    Western Blot detection against Immunogen (38.21 KDa) .
  • Storage Buffer:
  • 50 % glycerol
  • Storage Instruction:
  • Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
  • Applications
  • ELISA
  • Application Image
  • Western Blot (Recombinant protein)
  • ELISA
  • Gene Information
  • Entrez GeneID:
  • 5535
  • Gene Name:
  • PPP3R2
  • Gene Alias:
  • PPP3RL
  • Gene Description:
  • protein phosphatase 3 (formerly 2B), regulatory subunit B, beta isoform
  • Other Designations:
  • CBLP-like,OTTHUMP00000021813,calcineurin B, type II (19kDa),calcineurin B-like protein,protein phosphatase 3 (formerly 2B), regulatory subunit B (19kD), beta isoform (calcineurin B, type II),protein phosphatase 3 (formerly 2B), regulatory subunit B, 19kDa
  • RSS
  • YouTube
  • Linkedin
  • Facebook