PPP3CC monoclonal antibody (M01), clone 4D1
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
Western Blot (Transfected lysate)
Western Blot analysis of PPP3CC expression in transfected 293T cell line by PPP3CC monoclonal antibody (M01), clone 4D1.
Lane 1: PPP3CC transfected lysate (Predicted MW: 58.1 KDa).
Lane 2: Non-transfected lysate.
Sandwich ELISA (Recombinant protein)
Detection limit for recombinant GST tagged PPP3CC is 0.3 ng/ml as a capture antibody.
Western Blot detection against Immunogen (34.65 KDa) .
-
Specification
Product Description
Mouse monoclonal antibody raised against a partial recombinant PPP3CC.
Immunogen
PPP3CC (NP_005596.2, 1 a.a. ~ 81 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Sequence
MSGRRFHLSTTDRVIKAVPFPPTQRLTFKEVFENGKPKVDVLKNHLVKEGRLEEEVALKIINDGAAILRQEKTMIEVDAPI
Host
Mouse
Reactivity
Human
Isotype
IgG1 Kappa
Quality Control Testing
Antibody Reactive Against Recombinant Protein.
Western Blot detection against Immunogen (34.65 KDa) .
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Transfected lysate)
Western Blot analysis of PPP3CC expression in transfected 293T cell line by PPP3CC monoclonal antibody (M01), clone 4D1.
Lane 1: PPP3CC transfected lysate (Predicted MW: 58.1 KDa).
Lane 2: Non-transfected lysate.
Western Blot (Recombinant protein)
Sandwich ELISA (Recombinant protein)
Detection limit for recombinant GST tagged PPP3CC is 0.3 ng/ml as a capture antibody.ELISA
-
Gene Info — PPP3CC
Entrez GeneID
5533GeneBank Accession#
NM_005605Protein Accession#
NP_005596.2Gene Name
PPP3CC
Gene Alias
CALNA3
Gene Description
protein phosphatase 3 (formerly 2B), catalytic subunit, gamma isoform
Omim ID
114107Gene Ontology
HyperlinkGene Summary
Calmodulin-dependent protein phosphatase, calcineurin, is involved in a wide range of biologic activities, acting as a Ca(2+)-dependent modifier of phosphorylation status. In testis, the motility of the sperm is thought to be controlled by cAMP-dependent phosphorylation and a unique form of calcineurin appears to be associated with the flagellum. The calcineurin holoenzyme is composed of catalytic and regulatory subunits of 60 and 18 kD, respectively. At least 3 genes, calcineurin A-alpha (CALNA1; MIM 114105), calcineurin A-beta (CALNA2; MIM 114106), and calcineurin A-gamma (CALNA3), have been cloned for the catalytic subunit. These genes have been identified in humans, mice, and rats, and are highly conserved between species (90 to 95% amino acid identity).[supplied by OMIM
Other Designations
calcineurin A gamma
-
Interactome
-
Pathway
-
Disease
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com