PPP3CB monoclonal antibody (M01), clone 5D3
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
Western Blot (Transfected lysate)
Western Blot analysis of PPP3CB expression in transfected 293T cell line by PPP3CB monoclonal antibody (M01), clone 5D3.
Lane 1: PPP3CB transfected lysate(59.1 KDa).
Lane 2: Non-transfected lysate.
Sandwich ELISA (Recombinant protein)
Detection limit for recombinant GST tagged PPP3CB is approximately 0.03ng/ml as a capture antibody.
RNAi Knockdown (Antibody validated)
Western blot analysis of PPP3CB over-expressed 293 cell line, cotransfected with PPP3CB Validated Chimera RNAi ( Cat # H00005532-R01V ) (Lane 2) or non-transfected control (Lane 1). Blot probed with PPP3CB monoclonal antibody (M01), clone 5D3 (Cat # H00005532-M01 ). GAPDH ( 36.1 kDa ) used as specificity and loading control.
Western Blot detection against Immunogen (35.64 KDa) .
-
Specification
Product Description
Mouse monoclonal antibody raised against a partial recombinant PPP3CB.
Immunogen
PPP3CB (NP_066955, 435 a.a. ~ 524 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Sequence
LTPTGMLPSGVLAGGRQTLQSATVEAIEAEKAIRGFSPPHRICSFEEAKGLDRINERMPPRKDAVQQDGFNSLNTAHATENHGTGNHTAQ
Host
Mouse
Reactivity
Human
Interspecies Antigen Sequence
Mouse (98); Rat (97)
Isotype
IgG1 Kappa
Quality Control Testing
Antibody Reactive Against Recombinant Protein.
Western Blot detection against Immunogen (35.64 KDa) .
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Transfected lysate)
Western Blot analysis of PPP3CB expression in transfected 293T cell line by PPP3CB monoclonal antibody (M01), clone 5D3.
Lane 1: PPP3CB transfected lysate(59.1 KDa).
Lane 2: Non-transfected lysate.
Western Blot (Recombinant protein)
Sandwich ELISA (Recombinant protein)
Detection limit for recombinant GST tagged PPP3CB is approximately 0.03ng/ml as a capture antibody.ELISA
RNAi Knockdown (Antibody validated)
Western blot analysis of PPP3CB over-expressed 293 cell line, cotransfected with PPP3CB Validated Chimera RNAi ( Cat # H00005532-R01V ) (Lane 2) or non-transfected control (Lane 1). Blot probed with PPP3CB monoclonal antibody (M01), clone 5D3 (Cat # H00005532-M01 ). GAPDH ( 36.1 kDa ) used as specificity and loading control. -
Gene Info — PPP3CB
Entrez GeneID
5532GeneBank Accession#
NM_021132Protein Accession#
NP_066955Gene Name
PPP3CB
Gene Alias
CALNA2, CALNB
Gene Description
protein phosphatase 3 (formerly 2B), catalytic subunit, beta isoform
Omim ID
114106Gene Ontology
HyperlinkGene Summary
catalytic subunit
Other Designations
OTTHUMP00000019823|calcineurin A beta|calcineurin A2|protein phosphatase from PCR fragment H32
-
Interactome
-
Pathway
-
Disease
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com