PPP2R5C (Human) Recombinant Protein (Q01)
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
-
Specification
Product Description
Human PPP2R5C partial ORF ( NP_002710.2, 1 a.a. - 100 a.a.) recombinant protein with GST-tag at N-terminal.
Sequence
MLTCNKAGSRMVVDAANSNGPFQPVVLLHIRDVPPADQEKLFIQKLRQCCVLFDFVSDPLSDLKWKEVKRAALSEMVEYITHNRNVITEPIYPEVVHMFA
Host
Wheat Germ (in vitro)
Theoretical MW (kDa)
36.74
Preparation Method
Purification
Glutathione Sepharose 4 Fast Flow
Quality Control Testing
12.5% SDS-PAGE Stained with Coomassie Blue.
Storage Buffer
50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Storage Instruction
Store at -80°C. Aliquot to avoid repeated freezing and thawing.
Note
Best use within three months from the date of receipt of this protein.
-
Applications
Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
-
Gene Info — PPP2R5C
Entrez GeneID
5527GeneBank Accession#
NM_002719Protein Accession#
NP_002710.2Gene Name
PPP2R5C
Gene Alias
B56G, MGC23064, PR61G
Gene Description
protein phosphatase 2, regulatory subunit B', gamma isoform
Omim ID
601645Gene Ontology
HyperlinkGene Summary
The product of this gene belongs to the phosphatase 2A regulatory subunit B family. Protein phosphatase 2A is one of the four major Ser/Thr phosphatases, and it is implicated in the negative control of cell growth and division. It consists of a common heteromeric core enzyme, which is composed of a catalytic subunit and a constant regulatory subunit, that associates with a variety of regulatory subunits. The B regulatory subunit might modulate substrate selectivity and catalytic activity. This gene encodes a gamma isoform of the regulatory subunit B56 subfamily. Alternatively spliced transcript variants encoding different isoforms have been identified. [provided by RefSeq
Other Designations
B' alpha regulatory subunit|PP2A, B subunit, B' gamma isoform|PP2A, B subunit, B56 gamma isoform|PP2A, B subunit, PR61 gamma isoform|PP2A, B subunit, R5 gamma isoform|Serine/threonine protein phosphatase 2A, 56 kDa regulatory subunit, gamma isoform|gamma
-
Interactome
-
Pathway
-
Disease
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com