PPP2R5C monoclonal antibody (M01), clone 3G9
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
-
Specification
Product Description
Mouse monoclonal antibody raised against a partial recombinant PPP2R5C.
Immunogen
PPP2R5C (NP_002710.2, 1 a.a. ~ 100 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Sequence
MLTCNKAGSRMVVDAANSNGPFQPVVLLHIRDVPPADQEKLFIQKLRQCCVLFDFVSDPLSDLKWKEVKRAALSEMVEYITHNRNVITEPIYPEVVHMFA
Host
Mouse
Reactivity
Human
Isotype
IgG2a Kappa
Quality Control Testing
Antibody Reactive Against Recombinant Protein.
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Transfected lysate)
Western Blot analysis of PPP2R5C expression in transfected 293T cell line by PPP2R5C monoclonal antibody (M01), clone 3G9.
Lane 1: PPP2R5C transfected lysate(61.1 KDa).
Lane 2: Non-transfected lysate.
Sandwich ELISA (Recombinant protein)
Detection limit for recombinant GST tagged PPP2R5C is approximately 3ng/ml as a capture antibody.ELISA
In situ Proximity Ligation Assay (Cell)
Proximity Ligation Analysis of protein-protein interactions between TP53 and PPP2R5C. HeLa cells were stained with anti-TP53 rabbit purified polyclonal 1:1200 and anti-PPP2R5C mouse monoclonal antibody 1:50. Each red dot represents the detection of protein-protein interaction complex, and nuclei were counterstained with DAPI (blue). -
Gene Info — PPP2R5C
Entrez GeneID
5527GeneBank Accession#
NM_002719Protein Accession#
NP_002710.2Gene Name
PPP2R5C
Gene Alias
B56G, MGC23064, PR61G
Gene Description
protein phosphatase 2, regulatory subunit B', gamma isoform
Omim ID
601645Gene Ontology
HyperlinkGene Summary
The product of this gene belongs to the phosphatase 2A regulatory subunit B family. Protein phosphatase 2A is one of the four major Ser/Thr phosphatases, and it is implicated in the negative control of cell growth and division. It consists of a common heteromeric core enzyme, which is composed of a catalytic subunit and a constant regulatory subunit, that associates with a variety of regulatory subunits. The B regulatory subunit might modulate substrate selectivity and catalytic activity. This gene encodes a gamma isoform of the regulatory subunit B56 subfamily. Alternatively spliced transcript variants encoding different isoforms have been identified. [provided by RefSeq
Other Designations
B' alpha regulatory subunit|PP2A, B subunit, B' gamma isoform|PP2A, B subunit, B56 gamma isoform|PP2A, B subunit, PR61 gamma isoform|PP2A, B subunit, R5 gamma isoform|Serine/threonine protein phosphatase 2A, 56 kDa regulatory subunit, gamma isoform|gamma
-
Interactome
-
Pathway
-
Disease
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com