PPP2R2C monoclonal antibody (M01), clone 6D1
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
Western Blot (Cell lysate)
PPP2R2C monoclonal antibody (M01), clone 6D1 Western Blot analysis of PPP2R2C expression in HeLa ( Cat # L013V1 ).
Western Blot (Transfected lysate)
Western Blot analysis of PPP2R2C expression in transfected 293T cell line by PPP2R2C monoclonal antibody (M01), clone 6D1.
Lane 1: PPP2R2C transfected lysate(49.5 KDa).
Lane 2: Non-transfected lysate.
Sandwich ELISA (Recombinant protein)
Detection limit for recombinant GST tagged PPP2R2C is approximately 0.1ng/ml as a capture antibody.
Western Blot detection against Immunogen (37.84 KDa) .
-
Specification
Product Description
Mouse monoclonal antibody raised against a partial recombinant PPP2R2C.
Immunogen
PPP2R2C (NP_065149, 1 a.a. ~ 110 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Sequence
MGEDTDTRKINHSFLRDHSYVTEADIISTVEFNHTGELLATGDKGGRVVIFQREPESKNAPHSQGEYDVYSTFQSHEPEFDYLKSLEIEEKINKIKWLPQQNAAHSLLST
Host
Mouse
Reactivity
Human
Isotype
IgG1 Kappa
Quality Control Testing
Antibody Reactive Against Recombinant Protein.
Western Blot detection against Immunogen (37.84 KDa) .
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Cell lysate)
PPP2R2C monoclonal antibody (M01), clone 6D1 Western Blot analysis of PPP2R2C expression in HeLa ( Cat # L013V1 ).Western Blot (Transfected lysate)
Western Blot analysis of PPP2R2C expression in transfected 293T cell line by PPP2R2C monoclonal antibody (M01), clone 6D1.
Lane 1: PPP2R2C transfected lysate(49.5 KDa).
Lane 2: Non-transfected lysate.
Western Blot (Recombinant protein)
Sandwich ELISA (Recombinant protein)
Detection limit for recombinant GST tagged PPP2R2C is approximately 0.1ng/ml as a capture antibody.ELISA
-
Gene Info — PPP2R2C
Entrez GeneID
5522GeneBank Accession#
NM_020416Protein Accession#
NP_065149Gene Name
PPP2R2C
Gene Alias
B55-GAMMA, IMYPNO, IMYPNO1, MGC33570, PR52, PR55G
Gene Description
protein phosphatase 2 (formerly 2A), regulatory subunit B, gamma isoform
Omim ID
605997Gene Ontology
HyperlinkGene Summary
The product of this gene belongs to the phosphatase 2 regulatory subunit B family. Protein phosphatase 2 is one of the four major Ser/Thr phosphatases, and it is implicated in the negative control of cell growth and division. It consists of a common heteromeric core enzyme, which is composed of a catalytic subunit and a constant regulatory subunit, that associates with a variety of regulatory subunits. The B regulatory subunit might modulate substrate selectivity and catalytic activity. This gene encodes a gamma isoform of the regulatory subunit B55 subfamily. Alternatively spliced transcript variants encoding different isoforms have been identified. [provided by RefSeq
Other Designations
OTTHUMP00000115505|PP2A, subunit B, B-gamma isoform|PP2A, subunit B, B55-gamma isoform|PP2A, subunit B, PR55-gamma isoform|PP2A, subunit B, R2-gamma isoform|gamma isoform of regulatory subunit B55, protein phosphatase 2|phosphoprotein phosphatase 2A BR ga
-
Interactome
-
Pathway
-
Disease
-
Publication Reference
-
PPP2R2C Loss Promotes Castration-Resistance and Is Associated with Increased Prostate Cancer-Specific Mortality.
Bluemn EG, Spencer ES, Mecham B, Gordon RR, Coleman I, Lewinshtein D, Mostaghel E, Zhang X, Annis J, Grandori C, Porter C, Nelson PS.
Molecular Cancer Research 2013 Jun; 11(6):568.
Application：IHC-P, WB-Tr, Human, LNCaP, VCaP cells, Prostate tumors.
-
Association of decreased expression of protein phosphatase 2A subunit PR55{gamma} (PPP2R2C) with an increased risk of metastases and prostate cancer-specific mortality.
Elysia Sophia Spencer, Eric Gregory Bluemn, Richard Johnston, Xiaotun Zhang, Ryan Robert Gordon, Daniel Lewinshtein, Jared Lucas, Peter Nelson and Christopher R. Porter
Journal of Clinical Oncology 2012 May; [Epub].
Application：IHC-P, Human, Human prostate cancer.
-
PPP2R2C Loss Promotes Castration-Resistance and Is Associated with Increased Prostate Cancer-Specific Mortality.
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com