Product Browser

Last updated: 2017/1/15
  • Related Product Showcase

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

PPP2R2C polyclonal antibody (A01)

  • Catalog # : H00005522-A01
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Mouse polyclonal antibody raised against a partial recombinant PPP2R2C.
  • Immunogen:
  • PPP2R2C (NP_065149, 1 a.a. ~ 110 a.a) partial recombinant protein with GST tag.
  • Sequence:
  • MGEDTDTRKINHSFLRDHSYVTEADIISTVEFNHTGELLATGDKGGRVVIFQREPESKNAPHSQGEYDVYSTFQSHEPEFDYLKSLEIEEKINKIKWLPQQNAAHSLLST
  • Host:
  • Mouse
  • Reactivity:
  • Human
  • Quality Control Testing:
  • Antibody Reactive Against Recombinant Protein.
  • Storage Buffer:
  • 50 % glycerol
  • Storage Instruction:
  • Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
  • Applications
  • ELISA
  • Application Image
  • ELISA
  • Gene Information
  • Entrez GeneID:
  • 5522
  • Gene Name:
  • PPP2R2C
  • Gene Alias:
  • B55-GAMMA,IMYPNO,IMYPNO1,MGC33570,PR52,PR55G
  • Gene Description:
  • protein phosphatase 2 (formerly 2A), regulatory subunit B, gamma isoform
  • Gene Summary:
  • The product of this gene belongs to the phosphatase 2 regulatory subunit B family. Protein phosphatase 2 is one of the four major Ser/Thr phosphatases, and it is implicated in the negative control of cell growth and division. It consists of a common heteromeric core enzyme, which is composed of a catalytic subunit and a constant regulatory subunit, that associates with a variety of regulatory subunits. The B regulatory subunit might modulate substrate selectivity and catalytic activity. This gene encodes a gamma isoform of the regulatory subunit B55 subfamily. Alternatively spliced transcript variants encoding different isoforms have been identified. [provided by RefSeq
  • Other Designations:
  • OTTHUMP00000115505,PP2A, subunit B, B-gamma isoform,PP2A, subunit B, B55-gamma isoform,PP2A, subunit B, PR55-gamma isoform,PP2A, subunit B, R2-gamma isoform,gamma isoform of regulatory subunit B55, protein phosphatase 2,phosphoprotein phosphatase 2A BR ga
  • Gene Pathway
  • RSS
  • YouTube
  • Linkedin
  • Facebook