PPP2R2A (Human) Recombinant Protein (P01)
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
-
Specification
Product Description
Human PPP2R2A full-length ORF ( AAH41071, 1 a.a. - 447 a.a.) recombinant protein with GST-tag at N-terminal.
Sequence
MAGAGGGNDIQWCFSQVKGAVDDDVAEADIISTVEFNHSGELLATGDKGGRVVIFQQEQENKIQSHSRGEYNVYSTFQSHEPEFDYLKSLEIEEKINKIRWLPQKNAAQFLLSTNDKTIKLWKISERDKRPEGYNLKEEDGRYRDPTTVTTLRVPVFRPMDLMVEASPRRIFANAHTYHINSISINSDYETYLSADDLRINLWHLEITDRSFNIVDIKPANMEELTEVITAAEFHPNSCNTFVYSSSKGTIRLCDMRASALCDRHSKLFEEPEDPSNRSFFSEIISSISDVKFSHSGRYMMTRDYLSVKIWDLNMENRPVETYQVHEYLRSKLCSLYENDCIFDKFECCWNGSDSVVMTGSYNNFFRMFDRNTKRDITLEASRENNKPRTVLKPRKVCASGKRKKDEISVDSLDFNKKILHTAWHPKENIIAVATTNNLYIFQDKVN
Host
Wheat Germ (in vitro)
Theoretical MW (kDa)
74.91
Interspecies Antigen Sequence
Mouse (100); Rat (99)
Preparation Method
Purification
Glutathione Sepharose 4 Fast Flow
Quality Control Testing
12.5% SDS-PAGE Stained with Coomassie Blue.
Storage Buffer
50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Storage Instruction
Store at -80°C. Aliquot to avoid repeated freezing and thawing.
Note
Best use within three months from the date of receipt of this protein.
-
Applications
Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
-
Gene Info — PPP2R2A
Entrez GeneID
5520GeneBank Accession#
BC041071Protein Accession#
AAH41071Gene Name
PPP2R2A
Gene Alias
B55-ALPHA, B55A, FLJ26613, MGC52248, PR52A, PR55A
Gene Description
protein phosphatase 2 (formerly 2A), regulatory subunit B, alpha isoform
Omim ID
604941Gene Ontology
HyperlinkGene Summary
The product of this gene belongs to the phosphatase 2 regulatory subunit B family. Protein phosphatase 2 is one of the four major Ser/Thr phosphatases, and it is implicated in the negative control of cell growth and division. It consists of a common heteromeric core enzyme, which is composed of a catalytic subunit and a constant regulatory subunit, that associates with a variety of regulatory subunits. The B regulatory subunit might modulate substrate selectivity and catalytic activity. This gene encodes an alpha isoform of the regulatory subunit B55 subfamily. [provided by RefSeq
Other Designations
PP2A, subunit B, B-alpha isoform|PP2A, subunit B, B55-alpha isoform|PP2A, subunit B, PR55-alpha isoform|PP2A, subunit B, R2-alpha isoform|Serine/threonine protein phosphatase 2A, 55 KDA regulatory subunit B, alpha isoform|alpha isoform of regulatory subun
-
Interactome
-
Pathway
-
Disease
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com