PPP2CB purified MaxPab mouse polyclonal antibody (B01P)
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
Western Blot (Transfected lysate)
Western Blot analysis of PPP2CB expression in transfected 293T cell line (H00005516-T01) by PPP2CB MaxPab polyclonal antibody.
Lane 1: PPP2CB transfected lysate(34.1 KDa).
Lane 2: Non-transfected lysate.
Immunofluorescence
Immunofluorescence of purified MaxPab antibody to PPP2CB on HeLa cell. [antibody concentration 10 ug/ml]
-
Specification
Product Description
Mouse polyclonal antibody raised against a full-length human PPP2CB protein.
Immunogen
PPP2CB (AAH12022, 1 a.a. ~ 309 a.a) full-length human protein.
Sequence
MDDKAFTKELDQWVEQLNECKQLNENQVRTLCEKAKEILTKESNVQEVRCPVTVCGDVHGQFHDLMELFRIGGKSPDTNYLFMGDYVDRGYYSVETVTLLVALKVRYPERITILRGNHESRQITQVYGFYDECLRKYGNANVWKYFTDLFDYLPLTALVDGQIFCLHGGLSPSIDTLDHIRALDRLQEVPHEGPMCDLLWSDPDDRGGWGISPRGAGYTFGQDISETFNHANGLTLVSRAHQLVMEGYNWCHDRNVVTIFSAPNYCYRCGNQAAIMELDDTLKYSFLQFDPAPRRGEPHVTRRTPDYFL
Host
Mouse
Reactivity
Human
Quality Control Testing
Antibody reactive against mammalian transfected lysate.
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Transfected lysate)
Western Blot analysis of PPP2CB expression in transfected 293T cell line (H00005516-T01) by PPP2CB MaxPab polyclonal antibody.
Lane 1: PPP2CB transfected lysate(34.1 KDa).
Lane 2: Non-transfected lysate.
Immunofluorescence
Immunofluorescence of purified MaxPab antibody to PPP2CB on HeLa cell. [antibody concentration 10 ug/ml] -
Gene Info — PPP2CB
Entrez GeneID
5516GeneBank Accession#
BC012022Protein Accession#
AAH12022Gene Name
PPP2CB
Gene Alias
PP2CB
Gene Description
protein phosphatase 2 (formerly 2A), catalytic subunit, beta isoform
Omim ID
176916Gene Ontology
HyperlinkGene Summary
This gene encodes the phosphatase 2A catalytic subunit. Protein phosphatase 2A is one of the four major Ser/Thr phosphatases, and it is implicated in the negative control of cell growth and division. It consists of a common heteromeric core enzyme, which is composed of a catalytic subunit and a constant regulatory subunit, that associates with a variety of regulatory subunits. This gene encodes a beta isoform of the catalytic subunit. Two transcript variants encoding the same protein have been identified for this gene. [provided by RefSeq
Other Designations
PP2A-beta|protein phosphatase 2, catalytic subunit, beta isoform|protein phosphatase type 2A catalytic subunit|serine/threonine protein phosphatase 2A, catalytic subunit, beta isoform
-
Interactome
-
Pathway
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com